KEGG   Pseudomonas putida W619: PputW619_3328
Entry
PputW619_3328     CDS       T00675                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ppw  Pseudomonas putida W619
SSDB
Motif
Pfam: UPF0242 FUSC YabA GldM_N HAP1_N ISG65-75 Mod_r RNase_Y_N Filament
Other DBs
NCBI-ProteinID: ACA73813
UniProt: B1JB40
Position
3666665..3668173
AA seq 502 aa
MKANSLLKWLVPGVLLGIVLIIIKSWVAAPDGQRTHDPDKATLTAEQAKALGIAGDTPRD
TVATLIGQVKAMRSEMQTLKKGNDALQTENYRLRTREGNIDTRIQSTLSSVTQQVTEQRQ
QANDARQKAEQQHRETQGLLSRLKDQLTGKPAAKSDVPVGFGLEPGDEQQFAGPQAPADA
VQWIEPSNARAGQEDTGKADGPLSSLTSKFKDLHGLDDNAIDRGQDRLRAVAKGERDSEN
ARDRTEGARPVYTIPENSTLMGSIAMTALIGRVPVDGTVNDPYPFKVLVGPDNLTANGID
LPDVVGAVMSGTAAGDWTLSCVRGQVESITFVFSDGTVRTVPQPQKVVSRNRSSTQTSDT
EKIRGGLGYISDPYGIPCISGERRSNAQQYLGSQSLITAAGAGFAAALGSEQTNTSFINS
ASGSLGLSQNSGNSALNSVISGGIGDIREWINKLYGEAFAAIYVPPGAKVALHLDHEISI
DYEPKGRRVNHESPSVSVLDLD
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgaaagctaacagcctgctgaagtggttggtacccggggtcctgctgggcatcgtgctg
atcatcatcaaatcctgggtggccgctccagatggccagcgcactcacgatccggacaag
gccacactaactgccgagcaggccaaagccttgggcatcgccggcgacaccccgcgcgac
accgtggccacgctgatcggtcaggtcaaagcgatgcgcagcgagatgcagacgctgaag
aaaggcaacgatgcgctgcagaccgagaactaccggttgcgcacacgcgaaggcaacatc
gacacgcgcatccagagcacgctgagcagtgtcacccaacaggtcaccgagcagcgccag
caggccaacgatgcccggcagaaggccgagcagcagcaccgcgagacccaggggctgctc
tccaggctcaaggaccaacttaccggcaagccagccgcgaagtcagatgttcccgtgggc
ttcggtcttgagccaggcgacgagcagcagtttgcagggcctcaggcaccggcagatgcg
gtgcagtggatcgaaccgtcgaatgcacgcgccgggcaagaggacaccggcaaagctgat
ggtccgctgtcgtcgttgacctcaaagttcaaggacctgcacggtctggacgacaacgcc
atcgaccgtggccaggaccgcttgcgtgctgtcgccaaaggcgagcgtgactcggaaaac
gcccgggaccgtaccgaaggcgcccgccccgtctacaccatccccgagaattcgacgctg
atgggctcgatcgccatgaccgcgctcattggccgggtgccggtggacggcaccgtgaac
gatccctatccgttcaaggtgctggtggggccagacaacctcactgccaacggcatcgac
ctgccggacgtggtcggcgcggtcatgagcggcaccgccgccggtgactggacgttgtcc
tgcgtgcgcggccaggtcgagtcgatcacctttgtcttcagcgacggtaccgtgcgcacg
gtgccacagccgcagaaggtcgtcagccgcaatcgcagcagtactcaaacctcggacacc
gagaagatccgcggcggcctgggctacatctccgacccttacggcattccgtgcatttct
ggcgagcgccgctccaacgcccagcagtatctgggcagccagagcctgatcaccgcagcc
ggcgccggcttcgctgcagccctgggcagcgagcaaaccaacacctcattcatcaattcg
gccagcggcagcctgggcctgtcccagaacagcggtaacagcgcgctgaactcggtgata
agcgggggcattggcgacatccgtgagtggatcaacaagctctacggtgaagccttcgcc
gccatctacgtgccgcccggggcgaaagtggccctgcacctggaccacgaaatcagcatc
gactacgaacccaaaggccggagagtgaaccatgaaagcccatccgtctcggtactggat
ctggattag

DBGET integrated database retrieval system