KEGG   Pseudomonas putida W619: PputW619_3329
Entry
PputW619_3329     CDS       T00675                                 
Name
(GenBank) conserved hypothetical protein
Organism
ppw  Pseudomonas putida W619
SSDB
Other DBs
NCBI-ProteinID: ACA73814
UniProt: B1JB41
Position
3668136..3668555
AA seq 139 aa
MKAHPSRYWIWISLLLGLHLAGCSTSKEEMLPHGDHTMLDIWNGGGSVGTQQQLREARGE
LRRPVLDPERLINAQSAYTRTAANEIRTQFPRLPNPDLVMYVYPHLAGTQQTPVPGYSTV
FPLYEKVQYALPGERLDDL
NT seq 420 nt   +upstreamnt  +downstreamnt
atgaaagcccatccgtctcggtactggatctggattagcctgctgctcggcctgcacctg
gccggctgctccaccagcaaggaggaaatgctgccccacggcgatcacaccatgcttgat
atctggaacggcggtggctcggtcggtactcagcaacagctgcgggaggcccgcggcgaa
ctgcgtcggccggtgctggatcccgagcgcctgatcaacgcccagagcgcctacacgcgc
accgccgccaacgagatccgtacccagttcccacgcctgcccaatccagacctggtcatg
tacgtttacccgcatctggccggtacccaacagacgccggtgcctggctattcgaccgtg
ttcccgttgtacgagaaggtccagtacgcgctgcccggcgagcgcctggacgatctgtga

DBGET integrated database retrieval system