KEGG   Pseudomonas putida W619: PputW619_3330
Entry
PputW619_3330     CDS       T00675                                 
Name
(GenBank) conserved hypothetical protein
Organism
ppw  Pseudomonas putida W619
SSDB
Motif
Pfam: TraC_F_IV FtsK_SpoIIIE AAA_22 DUF87 AAA_29 AAA_10 T2SSE AIG1
Other DBs
NCBI-ProteinID: ACA73815
UniProt: B1JB42
Position
3668555..3671296
AA seq 913 aa
MADDASRDPSRWEPWRAAQRRRATLADEAAQYAHNPSFADHLPWVEYLEEEQSILLDDNR
SVGAVFELQPIGTEGREPEWLMAARDALEDALQDSFDEFDQAPWVVQFFCQDDSDFAPYL
ERLERYIAPRARGTPFTEAFLTSMQRHLDAVGKPGGLFDDHVVSHLPWRGSNRRIRLVVY
RWLGEQADEDGQNPVQLLSRTCDRLVASLQACGVSPHRLTGHDFYAWLLPWFNPAPALTD
ETPAAFYRRVPYPETEGSEELPLPFDHDFAERLFFQEPRSDSEQGLWYFDQQPHTVMVVD
KLRRPPHIGQLTGETRKGEALNALFDQLPEQAVMSLTLVITPQDVLEEQLNRLARKAIGE
NLASTQTRQDVEEARALIGRQHKLYRGTLALYLRGADEQQLRQRSVQAANVLLGAGLQPV
REGDEVAACNSYLRWLPMVYNPVRDPRNWYTRLLFAQHVANLLPLWGRSIGTGNPGITFF
NRGGAPLSFDPLSRFDRSMNGHLLLFGPTGAGKSATLVSILMQVMAVYRPRLFIVEAGNS
FGLQGDYFATLGLTVNKVQLKPGSDVSLAPFAHARRLIDHPDQVASLSTEDLDEAAPDSD
EQRDVLGELEITARLMITGGEAKEEARLTRADRSLIRECILDTARYCATTEQQVLTRHVR
DALRKVASDTHLPDKRRERAQEMAESIDLFCQGFEGALFDRPGTPWPESDVTIVDLATYA
REGYEAQMSISYISLMNTVNNIAERDQYLGRPIIMVTDEGHIITKNPLLAPFVVKGTKMW
RKLGAWFWLATQNMADLPDAAQTMLNMIEWWICLNMPPAEIEEIARFKKLTPAQKALLLS
ASKASGKYTEGVVLSKNLETLFRAVPPSLYLALAMTEPEEKAQRWRLMEEHQQSELEAAL
QVAAEIDRLRGIS
NT seq 2742 nt   +upstreamnt  +downstreamnt
atggctgatgacgcgagtcgcgatccgtcccgctgggagccctggcgcgcggcacagcgc
cgtcgcgccaccctggccgacgaagccgcccagtacgcgcacaaccccagcttcgccgac
cacctgccctgggtcgagtatctggaagaggagcagtccattctgctcgacgacaaccgt
tccgtgggcgcagtgttcgagctgcagccgatcggtaccgagggtcgtgagcccgaatgg
ttgatggctgcgcgcgacgccctggaagatgcgctgcaggacagcttcgacgagttcgac
caggcgccctgggtggtgcagttcttctgccaggacgacagtgactttgccccgtacctt
gaacgcctggaacgctatatcgcgccgcgcgcgcgaggtacgccgttcaccgaggccttc
ctcacgtcgatgcaacgccacctcgacgccgtcggcaagccgggcgggttgttcgacgac
catgtcgtgtctcacctcccctggcgcggcagcaatcggcggattcgcctggtggtctac
cgctggctcggggagcaggccgacgaggatgggcagaacccggtccagctgttgagccgc
acctgcgatcgtctggtggcctcgctgcaggcctgcggagtcagccctcaccggctgacc
gggcacgatttctacgcctggttgctgccctggttcaacccggcccctgccctcaccgac
gaaacgcctgccgcgttctatcgacgtgtgccctacccggagacggagggcagcgaggag
ctgccgttgccgttcgaccacgacttcgccgagcggctgttcttccaggaaccgcgctcc
gatagcgagcagggtctgtggtacttcgatcagcagccccacaccgtgatggtggtcgac
aagctgcgcagaccgccgcatatcggccaactgaccggtgagacgcgcaaaggtgaggcg
ttgaacgccttgttcgatcaattgcccgagcaggcggtgatgagcctgactctggtgatc
acgccccaggatgtgctcgaggagcaactcaatcgcctggcgcgcaaagccatcggcgag
aacctcgcctcgacccagacccgccaggacgtggaagaagcccgtgcgctgattggtcgc
cagcacaagctgtaccgtggcacgttggcgctgtacctgcgcggcgccgatgagcagcag
ctgcgccagcgttcggtccaagctgccaacgtattgctcggcgccggcctacaaccggtg
cgcgagggcgatgaagtggccgcctgcaacagctacctgcgctggttgccgatggtctac
aacccggtgcgggacccacgcaattggtacacccggctgctgtttgctcagcacgtcgcc
aacctgctgccgctctgggggcgcagcatcggtaccggcaacccgggtatcaccttcttc
aaccgcggtggcgcgccgctgtcattcgacccgctgtcgcgctttgaccgctcgatgaat
ggacacctgctgttattcggcccgaccggcgccggcaagtcggccaccctggtctcgatc
ctgatgcaggtcatggccgtgtaccggccgcggctgttcatcgtcgaggcgggcaactcc
tttggactacagggtgactatttcgccaccctcggcctaaccgtcaacaaggttcagctc
aaaccgggcagtgacgtaagcctggcgccgttcgcccatgcccggcgactgatcgaccat
ccggaccaggtcgccagtctgtcgactgaagacctggatgaggccgccccggacagtgac
gagcagcgcgatgtgttgggcgagctggagatcaccgcacggctgatgatcaccggcggc
gaagccaaagaagaggcgcgcctgacccgggcggaccgcagcctgatccgcgagtgtatc
ctggataccgcccgttactgcgcgacgactgagcagcaggtgctgacccggcatgttcgc
gatgccctgcgtaaggtcgccagcgacacccacctgcccgacaaacgccgtgagcgtgcg
caggagatggccgagtccatcgacctgttctgccagggtttcgaaggtgcactgttcgac
cggcccggcacaccctggccggagagcgacgtgacgatcgtcgacctcgccacgtacgcc
cgtgagggatacgaggcgcagatgtcgatcagctacatcagcctgatgaacacagtgaac
aacatcgccgagcgcgatcagtacctcggccgtccgatcatcatggtcaccgacgaaggc
cacatcatcactaagaacccgctgttggcgcccttcgtggtcaaaggcacgaagatgtgg
cgcaagctcggcgcctggttctggctggcaacgcaaaacatggccgacttgcccgatgcg
gcgcagaccatgctcaacatgatcgaatggtggatctgcttgaatatgccgccagcggaa
atcgaggaaatagcccgcttcaagaaactcacgccggcgcagaaagcgctgctgctctcc
gcaagcaaggcctcgggcaagtacaccgagggcgtggtcctgtcgaagaacctggagacg
ctattccgggcggtgccaccgagcctgtacctcgcgttggccatgaccgagcccgaggaa
aaagctcagcgctggcggttgatggaagagcaccagcagtccgagctggaagccgccctg
caggtcgcggcggagattgatcgcctgcgcggcatctcgtga

DBGET integrated database retrieval system