KEGG   Pseudomonas putida W619: PputW619_4285Help
Entry
PputW619_4285     CDS       T00675                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00970  Aminoacyl-tRNA biosynthesis
ppw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PputW619_4285
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ppw03029]
    PputW619_4285
Enzymes [BR:ppw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PputW619_4285
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PputW619_4285
Mitochondrial biogenesis [BR:ppw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PputW619_4285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ACA74765
UniProt: B1JDP2
Position
4721993..4723438
Genome map
AA seq 481 aa AA seqDB search
MQWEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNQEAVRMAC
MFGLAIDAQIGKRNVFARKNYFYPDLPKGYQISQMDLPIVGKGHLDIALEDGTIKRIGVT
RAHLEEDAGKSLHEDFSGSTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHALVRYL
GICDGNMAEGSLRCDCNVSIRPKGQAEFGTRCEIKNVNSFRFIERAINSEIQRQIDLIED
GGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPDPDLLPVVIEDSFLETIRTGLPELPP
QKVERFQSQYGLSAYDANVLASSREQADYFEQVVKIGGDAKLAANWVMVELGSLLNKLGI
EIDQAPVSAEQLGGMLLRIRDNTISGKIAKTVFEAMAAGEGDADSIIESKGLKQVTDTGA
IDKMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPGQVNQLLKAKLE
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgggaagttgtgatcgggctggaaatccatacccagctggccacccagtcgaag
atcttttccggcagcgccaccaccttcggctccgagccgaacacccaggcgagcctggtt
gaccttggcatgcccggcgtactgccggtgctgaaccaggaagcggtacgcatggcctgc
atgttcggcctggcgatcgatgcccagatcggcaagcgcaacgtgttcgcgcgcaagaac
tacttctaccccgacctgcccaagggctatcagatcagccagatggacttgccgatcgtc
ggcaagggccacctggacatcgccctggaagacggcaccataaagcgcatcggcgtaacc
cgcgcgcacctggaagaagacgccggcaagagcctgcacgaagacttcagcggctcgacc
ggtatcgacctgaaccgtgccggcaccccgctgctggaaatcgtctccgagccggacatg
cgcagcgccaaggaggccgtggcctacgtcaaggcgatccacgcgctggtgcgctacctg
ggcatctgcgacggcaacatggctgaaggctcgctgcgctgcgactgcaacgtctcgata
cggcccaaaggccaggccgagttcggcacccgctgcgagatcaaaaacgtcaactcgttc
cgcttcatcgagcgcgcgatcaacagcgagatccagcgccagatcgacctgatcgaagat
ggcggcaaggtcgtgcaggaaacccgcctgtacgacccgaacaaggacgagacccgctcc
atgcgcagcaaggaggaagccaacgactaccgttacttccccgacccggacctgctgccg
gtggtgatcgaggacagtttcctcgaaaccatccgtaccggcttgccggagctgccacca
cagaaggtcgagcgcttccagagccagtatggcctgtcggcctacgacgccaacgtactg
gcctccagccgtgagcaggcggactacttcgagcaagtggtgaagattggcggcgacgcc
aaactggcagccaactgggtcatggtcgaactgggcagcctgctgaacaagctgggtatc
gagatcgaccaggcaccggtcagtgccgagcaactcgggggcatgctgctgcgtatccgc
gacaacaccatcagcggcaagatcgccaagaccgtgttcgaggccatggccgccggtgaa
ggcgatgccgacagcatcatcgagagcaaaggcctgaaacaggtcaccgataccggcgcg
atcgacaagatgctcgatgaagtgcttgccgccaacgccgagcaggtcgaacagtaccgc
gccgccgatgaagccaagcgcggcaagatgttcggcttcttcgtcggccaggcgatgaag
gcctccaagggcaaggccaacccggggcaagtgaaccaattgctcaaggccaagctcgaa
gggtga

DBGET integrated database retrieval system