KEGG   Pseudomonas putida W619: PputW619_4329Help
Entry
PputW619_4329     CDS       T00675                                 

Definition
(GenBank) Nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00230  Purine metabolism
ppw00240  Pyrimidine metabolism
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01130  Biosynthesis of antibiotics
Module
ppw_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ppw_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ppw_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PputW619_4329
   00240 Pyrimidine metabolism
    PputW619_4329
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppw04131]
    PputW619_4329
Enzymes [BR:ppw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     PputW619_4329
Membrane trafficking [BR:ppw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    PputW619_4329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ACA74809
UniProt: B1JDQ6
Position
complement(4775639..4776064)
Genome map
AA seq 141 aa AA seqDB search
MAVQRTFSIIKPDAVAKNVIGKITTRFEEAGLKIVASKIKQLSKAEAEGFYAEHSERGFF
GDLVAFMTSGPVVVQVLEGENAIALNRELMGATNPKEAAAGTIRADFAESIDANAVHGSD
SEAAAAREIAYFFAATEVTTR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcaacgtactttctcgatcatcaagcctgacgcagttgccaaaaacgtcatc
ggcaagatcaccactcgcttcgaagaagccggcctgaaaatcgttgcttcgaaaatcaag
caactgtccaaagccgaagccgaaggtttctacgctgagcacagcgagcgcggcttcttc
ggtgacctggttgccttcatgacttccggtccggttgtcgttcaggttctggaaggcgaa
aacgccatcgctctgaaccgtgagctgatgggcgccaccaaccctaaagaagctgctgcc
ggcaccatccgtgctgacttcgccgagtcgatcgacgccaacgccgttcacggttcggac
tccgaagctgctgctgctcgcgaaatcgcttacttcttcgctgctaccgaggtaaccact
cgctaa

DBGET integrated database retrieval system