KEGG   Pseudomonas putida W619: PputW619_4582Help
Entry
PputW619_4582     CDS       T00675                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00071  Fatty acid degradation
ppw00072  Synthesis and degradation of ketone bodies
ppw00280  Valine, leucine and isoleucine degradation
ppw00310  Lysine degradation
ppw00362  Benzoate degradation
ppw00380  Tryptophan metabolism
ppw00620  Pyruvate metabolism
ppw00630  Glyoxylate and dicarboxylate metabolism
ppw00640  Propanoate metabolism
ppw00650  Butanoate metabolism
ppw00900  Terpenoid backbone biosynthesis
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01120  Microbial metabolism in diverse environments
ppw01130  Biosynthesis of antibiotics
ppw01200  Carbon metabolism
ppw01212  Fatty acid metabolism
ppw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PputW619_4582
   00630 Glyoxylate and dicarboxylate metabolism
    PputW619_4582
   00640 Propanoate metabolism
    PputW619_4582
   00650 Butanoate metabolism
    PputW619_4582
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PputW619_4582
   00072 Synthesis and degradation of ketone bodies
    PputW619_4582
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PputW619_4582
   00310 Lysine degradation
    PputW619_4582
   00380 Tryptophan metabolism
    PputW619_4582
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PputW619_4582
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputW619_4582
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PputW619_4582
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppw04147]
    PputW619_4582
Enzymes [BR:ppw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PputW619_4582
Exosome [BR:ppw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PputW619_4582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACA75062
UniProt: B1JF93
Position
complement(5059021..5060298)
Genome map
AA seq 425 aa AA seqDB search
MRSLRRVAILGGNRIPFARSNGAYATASNQAMLTVTLEGLIERYRLHGLRLGEVVAGAVL
KHSRDMSLTRECVLGSRLSPQTPAYDIQQACGTGLEAALLVANKIALGQIDSGIAGGVDT
TSDAPIGVNEGLRSILLQANRGRTLGERLKPFLQLRPGHLKPELPRNGEPRTGLSMGEHC
ERMALAWQIGRAEQDELALLSHQHLAAAYAEGWQDDLLTPFLGLTRDNNLRSDLTLEQLS
KLKPAFDRSGLGTLTAGNSTPLTDGASLVLLGTEEWAQAQGLPVLAYLVDGETAAVDFVK
GREGLLMAPAYAVPRLLARNGLTLQDFDYYEIHEAFAAQVLCTLKAWESAEFCREQLGLD
APLGAIDRSKLNVKGSSLAAGHPFAATGGRILANLAKLLATAGKGRGLISICAAGGQGVT
VIVER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcacttcgccgggtcgcgattctgggcggcaaccgaatccctttcgcccgctcc
aacggcgcctacgccactgccagcaaccaggcgatgctcacggtcacgctggagggcctg
atagaacgctaccgcctgcacggattgcgtctgggcgaagtagtggccggtgcggtgctc
aagcattctcgcgacatgagcctgacccgtgaatgcgtgctcggttcgcggctgtcgccg
cagacaccggcctacgacattcagcaggcttgcggcaccgggctggaggctgccctgctg
gtggccaacaagattgccctcgggcagatcgacagcggtattgccggtggcgtcgacacc
acgtccgatgccccgatcggggtcaatgaggggctgcggagcatcttgctgcaggccaac
cgcggcaggactctgggtgagcggttgaagcccttcctgcagttgcgcccggggcatctg
aaacccgagctgccgcgcaatggcgagccgcgtaccgggttgtcgatgggcgagcattgc
gagcgcatggccctggcctggcagatcggtcgcgccgagcaggacgagctggctctgctg
agccatcagcatctggcagcggcctatgccgagggttggcaggatgacctgctgacaccg
tttctgggccttacgcgcgacaacaacctgcggtcggacctgactcttgagcagttgagc
aagctcaagcccgcgttcgaccgcagtggtttgggcacactcacagcaggcaattccaca
ccgctgaccgatggtgcgtcgctggtgctgctgggcacagaggagtgggcgcaggcacag
ggcctgccggtgctggcctatctggtcgatggcgagactgctgccgtggacttcgtcaag
gggcgggaagggctgctgatggcgccggcctatgcggtgccgcggcttctggcgcgcaat
ggccttaccctgcaggacttcgattattacgagatccacgaggcatttgctgcgcaggtg
ctgtgcacgctcaaggcctgggaaagtgccgagttctgccgcgagcagctggggctggat
gcccccctgggtgcgatcgatcggagcaagctcaacgtcaaaggcagctcattggcggca
gggcacccgtttgcggctaccggggggcggatcctggccaacctcgccaaactgctggcg
acggctgggaaggggagaggcttgatttcgatctgcgcggcgggcgggcaaggggtgaca
gtgatcgtcgagcggtaa

DBGET integrated database retrieval system