KEGG   Pseudomonas putida W619: PputW619_4846Help
Entry
PputW619_4846     CDS       T00675                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00620  Pyruvate metabolism
ppw00630  Glyoxylate and dicarboxylate metabolism
ppw01100  Metabolic pathways
ppw01110  Biosynthesis of secondary metabolites
ppw01120  Microbial metabolism in diverse environments
ppw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PputW619_4846
   00630 Glyoxylate and dicarboxylate metabolism
    PputW619_4846
Enzymes [BR:ppw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PputW619_4846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DUF3355
Motif
Other DBs
NCBI-ProteinID: ACA75322
UniProt: B1JE61
Position
5344503..5346680
Genome map
AA seq 725 aa AA seqDB search
MTGYVQVGGLQVAKALYDFVNNEAIPGTGVKADAFWAGAEKIINDLAPKNKALLAKRDEL
QAKIDAWHQARKGQAHDAVAYKSFLQDIGYLLPQADDFQATTQNVDEEIAHMAGPQLVVP
VMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQGYNKVRGNKVIAFARAFLDEAA
PLAAGSHVDSTAYRIEGGKLVVALKGGSNSGLRDDAQLIGFHGDAAAPTAVLLKHNGLHF
EIQVDASTPVGSTDAAGVKDILMESALTTIMDCEDSVAAVDADDKVIVYRNWLGLMKGDL
AENVSKGGKTFTRTMNPDREYAAPNGGTVTLHGRSLLFVRNVGHLMTNPAILDAQGNEIP
EGIQDGLFTNLIALHNLNGNTSRKNTRTGSVYIVKPKMHGPEEVAFAAEIFSRVEDLLGM
PRNTVKVGIMDEERRTTVNLKACIKSAAERVVFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKNEKWIGAYENNNVDVGLATGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAATLHALHYHKVDVQARQRELASRTPASVDDILTIPLAADTNWSAEEIRNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISAQLLANWLRHGVVTQEQVLESL
QRMAAVVDKQNAGDALYRPMAPNFDDNVAFQAAVELVIEGAKQPNGYTEPVLHRRRREFK
ARNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactggatacgttcaagtcggtggccttcaggtcgccaaggccctgtacgacttcgtc
aacaacgaagcgatccctggaaccggcgtcaaggccgatgcgttctgggccggggcagaa
aagatcatcaacgacctcgccccaaagaacaaagccctgctcgccaagcgcgacgagctg
caagccaagatcgacgcctggcaccaggcacgcaaaggccaggcacacgacgccgtagcc
tataaaagcttccttcaggatatcggctatctgctgccacaagccgacgatttccaggcc
accacccagaacgtggacgaagaaattgcccacatggcaggcccacagctggtcgtgccg
gtgatgaacgcccgctttgccctgaacgccgccaacgcccgctggggttcgctgtacgac
gcactgtacggcaccgacgccatcagcgatgaaggcggcgccgaaaaaggtcagggctac
aacaaggtccgtggcaacaaggtcatcgccttcgcccgcgccttcctcgacgaagccgcg
ccgctggctgctggctcgcacgtcgactccaccgcttaccgcatcgaaggcggcaagctg
gtcgttgccctcaagggcggcagcaacagcggcctgcgtgacgacgcccagctgatcggc
ttccatggcgatgccgccgcgccaaccgccgtgctgctcaagcacaatggcctgcacttc
gaaatccaggtcgatgccagcaccccggtcggcagcaccgacgccgccggtgtcaaagac
atcctgatggaatcggcgctgaccaccatcatggactgtgaagactcggtcgctgccgtc
gatgccgacgacaaggtcattgtctaccgcaactggctgggcctgatgaaaggcgacttg
gccgagaacgtcagcaaaggcggcaagaccttcacccgcaccatgaacccggaccgcgag
tacgcagcgcccaatggcggcaccgtgacccttcacggtcgttcgctgctgttcgtgcgc
aacgtgggtcacctgatgaccaacccggcaattctcgacgcccaaggcaacgagattccc
gaaggcatccaggacggtctgttcaccaacctgatcgccctgcacaacctcaacggcaac
accagccgcaagaacacccgtaccggtagcgtctacatcgtcaaaccgaagatgcacggc
cctgaagaagtggcgttcgccgccgagatcttcagccgcgtcgaagacctgctgggcatg
ccgcgcaacaccgtcaaggtcggcatcatggacgaggagcgccgtaccacggtgaacctc
aaggcttgcatcaagtcggccgccgagcgcgtggtgttcatcaacactggcttcctcgac
cgtaccggcgacgagattcacacctcgatggaggccggcgccgtggtgcgcaaaggcgcc
atgaagaacgagaagtggatcggcgcctacgagaacaacaacgtcgacgtcggtcttgcc
accggcctgcaaggccgtgcgcagatcggcaaaggcatgtgggccatgccggacctgatg
gccgccatgctcgagcagaagatcgctcacccgctggccggtgccaacaccgcttgggtt
ccttcgccgaccgccgccaccctgcacgccctgcactaccataaagtcgacgtgcaggcg
cgtcagcgcgagctggccagccgcaccccggcctcggtcgacgacatcctgaccatcccg
ctggcagctgacaccaactggtcggcagaagagatccgcaacgagctggacaacaacgcc
cagggcatcctcggctatgtggttcgctggatcgaccagggcgtgggttgctccaaagtg
ccggacatcaacgatgtgggcctgatggaagaccgcgctaccctgcgtatctcggcccag
ctgctggccaactggctgcgccatggcgtggttacccaggagcaggtgctggaaagcctc
cagcgcatggccgccgtggtcgacaagcagaacgccggtgacgccctgtaccgcccgatg
gcgccgaacttcgacgacaacgtggcattccaggctgcagtggaactggtaatcgagggt
gccaagcaaccgaacggttataccgagccggtactgcaccgtcgccgccgcgagttcaag
gcgcgtaacgggctgtaa

DBGET integrated database retrieval system