KEGG   Pseudomonas putida W619: PputW619_4998Help
Entry
PputW619_4998     CDS       T00675                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K14268  5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00250  Alanine, aspartate and glutamate metabolism
ppw00310  Lysine degradation
ppw00650  Butanoate metabolism
ppw01100  Metabolic pathways
ppw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PputW619_4998
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PputW619_4998
   00310 Lysine degradation
    PputW619_4998
Enzymes [BR:ppw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PputW619_4998
    2.6.1.48  5-aminovalerate transaminase
     PputW619_4998
Amino acid related enzymes [BR:ppw01007]
 Aminotransferase (transaminase)
  Class III
   PputW619_4998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACA75474
UniProt: B1JEU6
Position
complement(5519663..5520940)
Genome map
AA seq 425 aa AA seqDB search
MSKTNESLMQRRVAAVPRGVGQIHPIFVESAKNSTVIDVEGRELIDFAGGIAVLNTGHLH
PKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDFDKKTLLVSTGSEAVENAV
KIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALFPSELHGVS
VDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPAPKELMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFPLAGVCGKAEIMDAIAPGGLGGTYA
GSPIACAAALAVIQVFEEEKLLDRSKAVGEHLTAGLRKIQEKHPIIGDVRGLGSMIAVEV
FEKGTHTPNAAAVAQVVAKARDKGLILLSCGTYGNVLRILVPLTAEDELLDKGLAIIEEC
FAELA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccttgatgcaacgtcgtgtagccgccgtcccacgtggcgta
ggccagattcacccgatcttcgtcgaaagcgcgaagaactcgaccgtgatcgacgttgaa
ggccgcgaactgatcgacttcgccggcggcatcgcagttctgaacaccggccacctgcac
cccaaagtggttgccgctgttcaagagcagctgaccaaagtcagccacacctgcttccag
gtactggcttacgagccttacgtagagctgtgcgagaagatcaacaagctggtcccaggt
gacttcgacaagaagaccctgctggtttccaccggctccgaagccgttgagaacgccgtg
aaaatcgcccgtgccgccactggccgtgctggtgtaatcgccttcaccggcggctaccac
ggccgcaccatgatgaccctgggcctgaccggcaaggttgtgccgtactccgcaggcatg
ggcctgatgccgggcggcatcttccgcgccctgttcccgagcgaactgcacggtgtcagc
gttgacgatgccatcgcttcggtcgagcgcatcttcaagaacgacgccgagccgcgcgac
atcgctgcgatcatcctcgagccggtacagggcgaaggcggcttcctgccagcgcctaaa
gagctgatgaagcgcctgcgcgccctgtgcgaccagcacggcattctgctgatcgccgac
gaagtacagactggtgcgggccggaccggcaccttcttcgccatggaacagatgggcgtc
gcgccggacctgaccaccttcgccaaatccattgctggcggcttcccgctggccggtgtt
tgcggcaaggccgagatcatggacgccatcgctccgggcggcctgggcggtacttacgcc
ggttcgccgatcgcctgtgctgcggctctggccgtcatccaggtgttcgaagaagagaag
ctgctggaccgcagcaaggcagtaggtgagcacctgaccgctggcctgcgcaagatccag
gaaaagcacccgatcattggcgacgtccgtggtctgggctcgatgatcgctgtggaagtc
ttcgaaaaaggcacccacaccccgaacgccgctgcggttgcccaagtggttgccaaagcc
cgtgacaagggcctgatcctgctgtcttgcggcacctacggcaacgttctgcgtatcctg
gttccgctgaccgccgaagatgagctgctcgacaagggcctggccatcatcgaagagtgc
ttcgctgaactggcctga

DBGET integrated database retrieval system