KEGG   Pseudomonas putida DOT-T1E: T1E_0033Help
Entry
T1E_0033          CDS       T02181                                 

Definition
(GenBank) vgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    T1E_0033
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppx02044]
    T1E_0033
Secretion system [BR:ppx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   T1E_0033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD
Motif
Other DBs
NCBI-ProteinID: AFO45892
UniProt: I7BP60
Position
30683..32668
Genome map
AA seq 661 aa AA seqDB search
MPSQSDLRYSFEALVGKAEFEVVSFELREGISAPFELELKLISFENDIDFGHLLDKPVLF
TILEGERPVRYVHGLVSRFSQAESGFYRTYYHALVEPQLARAKLRSNWRIFQHKTVPQIL
ELMLKRQGIDQYELRASMDHQVREFCVQAGETDLAFIARLAAEEGFVYRFAHSEKLHKLI
ITDRLQSLGLISHGAIKADDEDEGFCDDDEPVGPDSVLYQANSGGDQAIPCLRRLRYTEQ
VRTARQVQRDHTFTHPAYRQEHRAAGPFLEHQSKEYEYFDYPGRYKRDAVGKPFTENRIT
ALRHDVRIAEVQGDDVRLQPGLSFTLTGHPRDDLNAHWRVNTVTHKGHQFTSLQEEAAGA
DVSTRYEQTAVLVPGRTEWRPAPLKKPRIDGPHMATVVGPPGEEIYCDEWGRVKVSFPWD
RESQNNEFSSCWLRVSQGWAGSSWGSMAIPRIGQDVIIHYVNGDPDQPMITGRTYCGDQL
PPYDLPDHKTRMTIKSQTHKGEGFNELRFEDELGKEEVFIHAQRDQNTLVNHNQSLSVGV
DRTQQVGQDESVAIGRNRLRVVKANDTVKVGGGKNDLIAGDYEVEAGNSLRLKCGKTLIE
MHANGTLNITCETFNFTAQQTGQINTLAAKLDLNPTGGSAGAGANGRDSDSLKADVDGHF
D
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcctagccaatctgatttgcgctacagctttgaggctctcgttggcaaagctgaattc
gaagtggtgtcgttcgaactccgagagggcatcagcgcaccctttgaactggagctgaaa
ctgatcagcttcgaaaacgatatcgacttcggccatttgctcgacaaacccgtgctcttc
accatcctggagggcgaacgcccggtacggtacgtgcacggccttgtcagccgtttcagc
caggctgaaagcggcttctaccgcacctattatcacgcgctggtcgagccccaactggca
cgggccaaactgcgctcgaactggcgcatcttccagcacaagaccgttccgcaaattctc
gagctgatgctcaagcgccagggcattgaccagtacgaactgcgcgccagcatggaccat
caggtgcgcgaattctgcgttcaggccggtgagacggacttggcgttcatcgcccgcctg
gccgctgaagaaggcttcgtctaccgcttcgcgcacagtgaaaagctgcacaagctgatc
atcaccgatcggctgcagtccctcggcctgatcagccatggcgccatcaaggccgacgat
gaagacgagggcttctgcgatgacgacgagccggtaggccctgacagcgtgctgtaccaa
gccaacagcggtggcgatcaagccataccctgccttcgccgcttgcgctacaccgagcag
gtgcgcaccgctcgtcaggtgcagcgcgaccacaccttcacccacccggcctaccgccag
gagcacagagccgccgggcccttcctggagcatcagagcaaagagtacgaatacttcgat
tacccaggccgctataaacgcgatgccgtgggcaagccgttcaccgaaaaccgcatcaca
gcgctgcgccatgatgtgcgtattgccgaggtccagggcgatgacgtgcgtctgcaaccg
gggctcagtttcaccctgaccggtcacccacgtgacgacctcaatgcgcattggcgggtc
aacacggttacccataaaggccaccagttcaccagcctgcaggaagaagccgccggcgcc
gatgtaagcacgcgctacgagcagaccgcagtgctggtccccggtcggaccgaatggcgc
cctgcgccattgaaaaaaccacgaatcgacgggccgcacatggccaccgtcgtcggcccg
cctggcgaggaaatctactgcgatgaatggggccgggtaaaagtcagtttcccctgggac
cgcgaaagccagaacaacgagttcagttcgtgctggttgcgggtgtctcaaggctgggcg
ggtagcagttggggctcgatggccatccctcggatcggccaggacgtgatcatccattac
gtcaacggcgaccccgaccagccaatgatcaccgggcgcacttactgcggtgaccaactg
ccgccttacgacctgcccgatcacaaaacacgcatgaccatcaagagccagacccacaag
ggggaaggtttcaacgagctgcgtttcgaggatgagctgggcaaggaggaagtgttcatc
catgcccagagagatcagaacactctggtcaatcacaaccagtccctctctgtgggcgtc
gatcgcacccaacaggttggccaggacgaatcggtcgccattggccgcaatcgtctgcgc
gtcgtcaaggccaacgacaccgtgaaagtggggggtggcaaaaacgacctcatcgcaggc
gactacgaagtcgaagcgggcaactcgctacgcctcaaatgcggcaagacccttatcgaa
atgcatgccaacggcacgctgaacatcacctgcgagaccttcaacttcaccgcacagcag
accgggcagatcaacaccctggcggcaaagctcgacctcaacccaacgggtggttcggcg
ggcgcgggcgcgaacgggcgcgacagtgactcactcaaggctgacgtggatgggcatttc
gactag

DBGET integrated database retrieval system