KEGG   Pseudomonas putida DOT-T1E: T1E_0045Help
Entry
T1E_0045          CDS       T02181                                 

Gene name
pitA
Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ppx  Pseudomonas putida DOT-T1E
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    T1E_0045 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 MHC2-interact
Motif
Other DBs
NCBI-ProteinID: AFO45904
UniProt: I7C2J4
Position
48167..49783
Genome map
AA seq 538 aa AA seqDB search
MATPSVASSPLLAKHDARPQLSHKPGRATLTLFFSLLLAGIAYTAWSLKQDVTASGTVIT
TATPFLLLGLALVIALGFEFVNGFHDTANAVATVIYTHSLPAPVAVVWSGLCNFLGVLFS
SGAVAFGIIALLPVELILQVGSSAGFAMVFALLLAAIIWNLGTWWLGLPASSSHTLIGSI
IGVGVANALMHGRDGTSGVDWAQASKVGYALLFSPLIGFACAALLLLALRALVKRKALYQ
APEGQTPPPWWIRSLLILTCTGVSFAHGSNDGQKGMGLIMLILVGTLPMAYALNKTMPNA
QALQFSAVAEVTRQALVRSNPQAAPDDPRQVLTLFIAQPKASPHLVPALAALTGMIGEEV
KGYGSLKRVPAEAMANVRNDMYLTSEAIRLMEKNHLVTFDADTRSQVLLFKAQVDDATRY
IPLWVKVAVAIALGLGTMVGWRRIVVTVGEKIGKTHLSYAQGASAEVVAMCTIGAADMFG
LPVSTTHVLSSGVAGAMVANGSGIQKRTLFNLLMAWVLTLPAAMLLAGSLYWLLNHIF
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccccgtcagtggccagcagcccactactggccaaacacgacgctcgcccgcag
ctctcccacaaacctgggcgtgccaccttaacgttgttcttcagcctgctgctggcgggt
atcgcctacaccgcctggagcctcaagcaggatgtgaccgcaagcggtacggtcatcacc
acggccacaccgttccttctgctgggcctggcgctggtgattgccctgggcttcgagttc
gtcaacggcttccacgacaccgccaacgcggtagccaccgtgatatacacccattcattg
ccggcgccggtagcggtggtgtggtctgggctgtgcaatttcctgggcgtgcttttttcc
agtggcgcggtggccttcggcatcatcgccttgctaccggtagaactgattctacaggtg
ggttcttcggccggcttcgccatggtcttcgccctgctgctggcggcgatcatctggaac
cttggcacttggtggctgggcctgccggcatcgtcctcgcacaccctgatcggctcgatc
atcggcgtgggcgtggccaatgcgctgatgcatgggcgtgacggcaccagcggcgtggac
tgggcccaggccagcaaggtgggttatgccctgctgttctcaccgctgatcggttttgct
tgtgcagccctgctgctgctggccctgcgcgcgctggtcaaacgcaaggcgctttaccag
gcaccggaaggccaaacaccgccaccgtggtggatccgcagcctactgattctgacgtgc
accggggtctcttttgcccacggctccaacgatggccagaaaggcatggggctgatcatg
ctgattctggtcggcaccctgccgatggcctatgcgctgaacaagaccatgcccaacgcg
caggccctgcagttttccgccgtcgccgaggtgacccgccaggcactggtacgcagcaac
ccgcaagcggccccggatgacccgcgccaggtgcttaccctgttcattgcccagcccaag
gccagcccgcacctggtaccggcattggcggcgctgaccgggatgatcggcgaagaggtc
aaaggctatggctcgctcaaacgcgtaccggctgaagccatggccaacgtgcgcaacgac
atgtacctgaccagtgaagccatccgcctcatggagaaaaaccacctggtgacattcgat
gccgacacccgcagccaagtgctgttgttcaaggcccaggtggacgacgccacccgctat
attccgttgtgggtgaaggtggctgtagccatcgcgctcgggctggggaccatggttggc
tggcggcgtattgtggtcaccgttggcgagaagatcggcaagacccacctcagctatgcc
caaggcgcatcggctgaagtggtggcgatgtgcaccattggcgcggcggatatgttcggg
ttgccggtgtcgaccacgcatgtgctgagttcgggggtggccggcgccatggtcgccaat
gggtcggggattcagaaacgcacgttgttcaatctgctgatggcctgggtgctgaccctg
ccagcggcaatgctgttggctggcagcctgtactggctgctgaaccacatcttctga

DBGET integrated database retrieval system