KEGG   Pseudomonas putida DOT-T1E: T1E_0048
Entry
T1E_0048          CDS       T02181                                 

Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    T1E_0048
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppx02044]
    T1E_0048
Secretion system [BR:ppx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   T1E_0048
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AFO45907
UniProt: I7BP76
Position
complement(51970..52767)
AA seq 265 aa
MSRLAFLMASLLIVLVGLPGCTSLSRATKVVLDHSLPIGPPKDAPTQVAFSINVSPTLNS
NPNSVDVAAIPESILEPSPYAVTLSAGDPHALTDKVGTLLAYLQAQFPAMSRVETGEEDQ
SEWARSPMEESSPGSYDAPTVVLTLPGSKAEASGPVATPIAIKILQLRDDSLLRNSVYQL
LDDDPAKALRSTYIRDDDYLLNPGQFKFIPFEPIEPETRFVAVIGDYSNQQNATWQHVLR
IPPRGHQIILSVLVNDAQILLKEEE
NT seq 798 nt   +upstreamnt  +downstreamnt
atgagccgcctggctttcttgatggcgtctctgctgatcgtgctggtcgggctgccaggt
tgcacgtccttgagcagagccaccaaggtggtgctggatcactcgttaccaatcgggccg
cccaaggacgcccccacccaagtcgcgttcagcatcaacgtcagcccaacgctcaacagc
aacccgaacagtgtcgacgtggcggccatccctgagagcatcctggaacccagcccctac
gcagtcaccttgagtgccggcgatccgcacgcactgaccgacaaagtcgggaccttgctc
gcatacctgcaagcgcaattccccgcgatgtcccgcgtggaaaccggcgaagaggaccaa
agcgaatgggctcgctccccgatggaagaaagctcgcccggcagctatgacgcccccacg
gtggtgctcacgctgccgggcagcaaggccgaagccagcgggcctgtcgccacaccgatt
gccatcaagattctgcaactgcgtgatgactccctgctgcgcaacagcgtgtaccaactg
ctggacgatgaccccgccaaggcactgcgcagtacctacatccgcgatgacgattacctg
ctgaacccaggccagttcaagttcataccgtttgagcccatcgagcccgagacccgcttc
gtcgcggtgatcggcgactacagcaaccagcaaaacgcgacctggcagcacgtgttgcga
attccgccacgcggccaccagatcattctctcagtgctggtcaatgacgcgcagatcctg
ctcaaggaggaggaatga

DBGET integrated database retrieval system