KEGG   Pseudomonas putida DOT-T1E: T1E_0053Help
Entry
T1E_0053          CDS       T02181                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    T1E_0053
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppx02044]
    T1E_0053
Secretion system [BR:ppx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   T1E_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: AFO45912
UniProt: I7BP82
Position
complement(56130..57617)
Genome map
AA seq 495 aa AA seqDB search
MPKPSTTVTVETQAETLSNATLLDQIMAETKLVPTQEGYQVARQGVSAFIAEILKSHDPD
QLINKHRVDQMIAELDRVLSKQMDAILHEPAFQQLESAWRSLKLLVDRTDFRENIKLEVL
HVSKEDLLDDFENAADITCSGIYKHVYTAGYGQFGGEPVAAMVGNYNFGPSSPDIKLLSY
MASVGAMSHAPFIAAPSPEFFNLSSFEALPNLKEIKDIFAGPRHAKWRAFRESEDARHIA
LTGPRFMLRSAYHHQDQPISSFHYDENINGRHDNYLWGSSAFLLASCINDSFARYRWCPN
IIGPQSGGAVEGLPVHLYESLGQLQAKIPTEVLISDRKEFELAEEGFIALTMRKDSDNAA
FFSANSVQKPKNFPKTPEGLQAQTNYKLGTQLPYLFIVNRLAHYIKVLQREQIGSWKERR
DLESELNKWIKQYVADQENPSADVRSRRPLRAARVEVSDVAGDPGWYQVSLAVRPHFKYM
GANFEISLVGRLDTQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagccaagcacaactgtcactgttgaaacacaggccgaaacactgagcaatgcc
accttgctcgaccagatcatggcagagaccaagttggttcccacacaagagggttaccaa
gtggccaggcagggtgtatccgccttcattgccgaaattctaaaaagtcatgacccagat
caattgatcaacaaacatcgcgtcgaccagatgattgccgagctggatcgggtcctcagc
aagcagatggatgccattctgcatgaacccgcgttccagcaacttgaatccgcgtggcgc
agcctcaaacttctggtcgaccgtacggactttcgcgagaacatcaagctcgaagtcttg
cacgtcagcaaggaagacttgctcgatgatttcgagaacgccgccgacattacctgcagt
ggtatttataaacacgtctataccgccggttacggccagttcggtggcgagccggtcgcg
gccatggttggcaattacaacttcggcccctcttcgcctgatatcaaactgttgagctac
atggcatccgtcggcgccatgtcgcatgcgcccttcattgcggcaccctcccccgagttc
ttcaacctcagcagcttcgaagcgctacccaatctgaaagaaatcaaagacatcttcgcc
ggcccacggcatgccaagtggcgcgcgttccgcgagagcgaagatgcccgccacatcgcg
ctgaccgggccgcgcttcatgctgcgctccgcctaccatcaccaggaccagccgatcagc
agcttccattacgatgagaacatcaacggccggcacgacaattacctgtggggcagctca
gccttcctgttggccagctgcatcaacgacagctttgcccgctaccgctggtgccccaac
atcatcggcccgcaatcgggaggtgccgtcgaaggcctgccggtgcatctgtacgaatcg
ctgggccagctgcaggccaagattcctaccgaggtactgatttccgaccgcaaggaattc
gagctggccgaagagggctttatcgccctgaccatgcgcaaggacagcgacaacgccgcg
ttcttctcagccaactcggtgcaaaagccgaaaaacttccccaagacacccgaaggcctg
caggcacagaccaactacaagctcggcacccaactgccctacctgttcatcgtcaatcgc
ctggcccactacatcaaggtgttgcagcgcgagcagatcggcagctggaaggagcgacgg
gaccttgagtccgaactcaacaaatggatcaagcaatacgtcgccgaccaggaaaaccct
tcggccgatgtgcgcagccgtcggccgttgcgtgctgccagggtcgaggtctcggacgtg
gcgggtgatccgggctggtaccaggtctcgctcgccgtgcgcccgcacttcaagtacatg
ggcgcgaacttcgaaatttccctggtaggccggctcgacacgcaatga

DBGET integrated database retrieval system