KEGG   Pseudomonas putida DOT-T1E: T1E_0054
Entry
T1E_0054          CDS       T02181                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    T1E_0054
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppx02044]
    T1E_0054
Secretion system [BR:ppx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   T1E_0054
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFO45913
UniProt: I7B3N5
Position
complement(57635..58138)
AA seq 167 aa
MTKPSDSVAPKERINIKYVPATGDEQAEVELPHKMMVLGDFGLDDSRSLEDRQVMRIDKH
TFNNVLNDADVSLAMSVPSALGATPDAELAVNLQFKSIQDFGPDRIARQVPELNKLLQLR
EALVALKGPLGNVPTFRKQLQHLLNDAHARKQLAQELDLVLEAPKAD
NT seq 504 nt   +upstreamnt  +downstreamnt
atgactaaaccctccgactccgttgcacccaaagaacgcatcaacatcaagtatgtgccc
gccaccggtgacgagcaggccgaggtagaactgccgcacaagatgatggtgctgggcgac
ttcggcctcgatgacagccgctccctcgaagaccgtcaggtcatgcgcatcgataaacac
accttcaacaacgtgttgaacgacgccgatgtgagcctggccatgtcggtgccctccgcg
cttggcgctactccggatgcagagctggcagtcaacctgcaattcaagtccatccaggac
ttcgggccagaccgcatcgcacgccaggtgcccgagctgaacaagctgctgcagctgcgt
gaagcgctggtcgccctgaaaggcccgctgggcaacgtgcccaccttccgcaaacagctg
cagcaccttctgaacgacgcgcatgcccgcaagcaactcgcgcaagaactggacctggtg
cttgaagcgccaaaagccgactga

DBGET integrated database retrieval system