KEGG   Pseudomonas putida DOT-T1E: T1E_0271Help
Entry
T1E_0271          CDS       T02181                                 

Gene name
yhcR
Definition
(GenBank) 5'-nucleotidase domain-containing protein
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00230  Purine metabolism
ppx00240  Pyrimidine metabolism
ppx00760  Nicotinate and nicotinamide metabolism
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    T1E_0271 (yhcR)
   00240 Pyrimidine metabolism
    T1E_0271 (yhcR)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    T1E_0271 (yhcR)
Enzymes [BR:ppx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     T1E_0271 (yhcR)
CD molecules [BR:ppx04090]
 Proteins
  T1E_0271 (yhcR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-ProteinID: AFO46130
UniProt: I7AU42
Position
complement(313878..315560)
Genome map
AA seq 560 aa AA seqDB search
MKVRLSCNYRSAIAWACLAISAGSLAAQPPAPVQINVVAINDLHGYLEPNPQDYAGAQGA
TRLTYGGIATLGAMLDELRTQDPDLLFIGAGDLIGGSPAISALWADEPVLEALNAMGMIV
SASGNHELDAGKAEFLRQIHGGCESTRPEKACTFRGDYPGSGFPYIASNLIDTTTGERLL
PAYHIQEVKGVKIAFVGAVPRNMEKVVSASAFAGLKATDEAQAINDVIPELKAKGVNAII
AVMHQGGDTVEPFDTQDCSQLSGAVVDVAKRLDPAVDAVISGHSHASYQCKVGDLSITQA
GKYGHFLTQLKLQVTPGTHHVTNITARNIPADPQNYLPNAKLTSLLEEVRQRSGEKLLEP
IGRISTAELDRKENAAGETTLGNLVTDAQLAMTQAFNTQIAFLNLGGLRSDLIQPADSDL
TYEQLFAVQPFNNPLVVQELTGKQITELLNLQWNRGSFNPLQVSKGFHYEWDGSRPVGSR
VVEGSVRLHGKPVEPLTHYRVVSNLFLADGGGGLATFKEGRRRQDTGISDLEALVAYVRQ
NHERGIAIGQRSEPRISMTP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtccgtctttcttgcaactatcgctcggctattgcctgggcatgccttgccatc
agcgcaggcagccttgccgcacagccacctgcccccgtccagatcaacgtcgtggctatc
aatgatcttcacggctacctggaacccaacccccaggactacgccggcgcgcaaggcgct
acccgcctgacctacggcggtatcgccacactcggcgccatgctcgatgaactgcgaacg
caggaccccgatctgctgttcatcggggctggcgacttgatagggggcagccctgccatt
tctgcgctgtgggctgacgagcctgtgcttgaggccttgaacgcgatgggcatgattgtc
agcgcatccgggaaccacgaactggatgcaggcaaggccgagtttcttcgtcagatccac
ggaggatgcgagtcaacgcgccctgaaaaggcctgcacgtttcgcggcgattatccagga
agtggcttcccttacatagcgtccaacctgatcgataccaccacgggcgagcgcttgcta
ccggcctatcacattcaagaggtgaaaggggtcaagatagcgttcgtcggtgccgtgcca
cgcaacatggaaaaagtggtctcggccagcgcattcgcagggctcaaagccacagatgaa
gcgcaagccatcaatgacgtgattccggagctcaaggccaaaggcgtcaatgcaatcatc
gcggtcatgcaccagggaggggataccgtcgagccgttcgacacgcaggattgcagccag
ctgagtggcgcggtcgtcgacgtggcgaagcggctggatcctgcggtagatgctgtcatc
agcggtcactcgcatgccagctatcaatgcaaggtgggtgacctgagcatcactcaggct
ggcaaatacggccacttcctgactcagttgaagttgcaggtaacgccaggcacccatcac
gtcacgaacatcaccgcccgcaatattcctgctgacccacagaactacctgccgaatgcc
aagttgacgagtttgctggaggaagtgcgtcagcggtccggggaaaaattgctcgaaccc
ataggacgcatctcgacggcagaacttgaccgcaaagaaaatgccgccggtgaaacaacc
ttggggaacctggtcacggatgcccaattggccatgacccaagcgtttaatacccagatt
gcctttctcaatctgggtgggctgcgaagtgacctgatacagcctgccgatagcgacctg
acctacgaacaattatttgccgtacaaccgttcaataacccactggtggttcaggaactg
acaggcaagcagattaccgaactgctcaaccttcaatggaacaggggcagtttcaatccg
ctgcaagtatcgaagggttttcattatgagtgggatggttcacggcctgtcggcagccgt
gtcgtcgagggcagtgtgcgtcttcacggcaaacccgttgagccgttgacccattatcgc
gtcgtcagcaacctgttcctggccgatggtggcggtggcttggccactttcaaagaagga
aggcgacgccaggacaccggcatctccgacctggaagccttggtggcgtatgtacgccag
aaccatgagcggggtattgcaattggccagcgcagcgagccgcgcatcagcatgacgccc
tga

DBGET integrated database retrieval system