KEGG   Pseudomonas putida DOT-T1E: T1E_0574Help
Entry
T1E_0574          CDS       T02181                                 

Gene name
cat1
Definition
(GenBank) acetyl-CoA hydrolase/transferase family protein
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00020  Citrate cycle (TCA cycle)
ppx00620  Pyruvate metabolism
ppx00650  Butanoate metabolism
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01120  Microbial metabolism in diverse environments
ppx01130  Biosynthesis of antibiotics
ppx01200  Carbon metabolism
Module
ppx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    T1E_0574 (cat1)
   00620 Pyruvate metabolism
    T1E_0574 (cat1)
   00650 Butanoate metabolism
    T1E_0574 (cat1)
Enzymes [BR:ppx01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     T1E_0574 (cat1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom
Motif
Other DBs
NCBI-ProteinID: AFO46432
UniProt: I7BQQ7
Position
complement(649871..651364)
Genome map
AA seq 497 aa AA seqDB search
MYRDRIRLSSLHSKVMSAADAAGLIEDGMTVGMSGFTRAGEAKAVPHALAERAKQSPLKI
SLMTGASLGNDLDKQLTEAGVLARRMPFQVDSTLRKAINDGQVMFIDQHLSETVEQLRNQ
QLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKQVIVEINLSHNTNLEGLHDIYI
PTYRPTRTPIPLVKVDDRIGSTAIPIDPAKIVGIVISDQPDSPSTVLPPDDETQGIADHL
INFLKKEVDAGRMTNKLGPLQAGIGSIANAVMCGLIESPFEDLTMYSEVLQDSTFDLIDA
GKLSFASGSSITLSTRRNADVFGNLERYKDKLVLRPQEISNHPEVVRRLGIIGINTALEF
DIYGNVNSTHVCGTRMMNGIGGSGDFARNAHLAVFVTKSIAKGGAISSVVPMVSHVDHTE
HDVDILVTEQGLADLRGLAPRERARAIIDNCVHPDYRAALNDYFDRACQRGGHTPHILRE
ALSWHENLEETGRMLAS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtgatcgtatccgcttgtcctccctgcacagcaaggtaatgagtgcggctgat
gccgctggtctgatcgaggacggcatgactgtcggcatgagcggcttcacccgcgccggc
gaagccaaggccgtaccgcatgcactggccgaacgtgccaagcaatcgccactgaaaatc
agcctgatgaccggcgccagcctgggcaatgacctggacaaacaactgaccgaggccggt
gtgttggcccgccgcatgccgttccaggtcgacagcaccctgcgcaaagccatcaatgac
ggccaggtgatgttcattgaccagcacctgtcggaaaccgtcgagcaactgcgcaaccag
cagctgaagctgccggacatcgcggtcatcgaagccgtggccatcaccgagcaaggccac
atcgtgccaaccacgtcggtgggcaactcggccagcttcgcgatcttcgccaagcaggtg
attgtagagatcaacctctcgcacaacaccaacctcgaaggcctgcacgacatctatatc
ccaacctaccgtccgactcgcacgccaatcccgctggtcaaggtagacgaccgtatcggc
agcaccgcgatcccgatcgacccggccaagatcgtcggtatcgtcatcagtgaccagcca
gactcgccgtccactgtgctgccgccagatgatgaaacacagggcatcgccgaccacctg
atcaacttcctcaagaaggaagtggatgcaggccgtatgaccaacaagctcggcccgctg
caagccggcattggcagcattgccaatgcggtgatgtgcggcctgatcgagtcgccgttc
gaagacctgaccatgtactccgaagtgctgcaggactccaccttcgacctgatcgacgcc
ggcaagcttagcttcgcatcgggcagctcgatcaccctgtcaacgcgccgcaatgccgat
gtgttcggcaacctggagcgctacaaggacaagttggtgctacgcccgcaggaaatctcc
aaccacccggaagtggtacgtcgcctgggcatcatcggtatcaacaccgcactggagttc
gatatctacggcaacgtcaactccactcacgtctgtggcaccaggatgatgaacggcatc
ggtggctccggcgacttcgcccgtaacgcccacctggccgtgttcgtcaccaagtcgatt
gccaaaggcggggcgatttccagcgtggtgccaatggtcagccatgtcgaccacaccgag
cacgacgtggacatcctggtcaccgagcagggcctggcggacctgcgtggcctggcgccg
cgcgagcgggcgcgagcgatcatcgacaactgcgtgcacccagactaccgcgctgcgctg
aacgactacttcgaccgtgcctgccagcgtggcggccataccccgcacatcctgcgtgaa
gccctgagctggcacgaaaacctggaagaaaccgggcgcatgctggctagttga

DBGET integrated database retrieval system