KEGG   Pseudomonas putida DOT-T1E: T1E_1693Help
Entry
T1E_1693          CDS       T02181                                 

Gene name
gatA
Definition
(GenBank) Glutamyl-tRNA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00970  Aminoacyl-tRNA biosynthesis
ppx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    T1E_1693 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ppx03029]
    T1E_1693 (gatA)
Enzymes [BR:ppx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     T1E_1693 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     T1E_1693 (gatA)
Mitochondrial biogenesis [BR:ppx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    T1E_1693 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AFO47544
UniProt: I7C783
Position
1851717..1852187
Genome map
AA seq 156 aa AA seqDB search
MHQLTLAEIARGLADKSFSSEELTGALLARIKQLDPQINSFISITDDLALAQARAADARR
AAGETGVLLGAPIAHKDLFCTNGVRTSCGSKMLDNFKAPYDATVVAKLAEAGMVTLGKTN
MDEFAMGSANESSHYGAVKNPWNLEHVPGGSSGGNK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaattgaccctggccgagatcgcccgcggactcgccgacaaatcgttttcttcc
gaagagctgaccggcgccctgctggcgcgcatcaaacagctcgacccgcagatcaacagc
ttcatcagcatcaccgacgacctggccctggctcaggcgcgtgccgccgatgcccgtcgc
gccgctggcgaaaccggcgtgctgctgggtgcaccgatcgcccacaaagacctgttctgc
accaacggcgtacgcaccagctgcggctcgaagatgctcgacaacttcaaggcgccctat
gacgccaccgtggtcgccaagctggccgaagccggcatggtcaccctgggcaagaccaac
atggacgagttcgccatgggttcggccaacgaatccagccattacggcgcggtgaagaac
ccgtggaacctcgagcacgttccgggcgggtcgtccggtggtaataaatag

DBGET integrated database retrieval system