KEGG   Pseudomonas putida DOT-T1E: T1E_2459
Entry
T1E_2459          CDS       T02181                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    T1E_2459
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppx02044]
    T1E_2459
Secretion system [BR:ppx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   T1E_2459
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFO48306
UniProt: I7C5B0
Position
complement(2701708..2702247)
AA seq 179 aa
MAKKESTQHKLDRVRAPRVHITYDVDIGDAIEKKELPFVVGVLGDFSGNPLEPLPKLKDR
KFVYIDRDNFNGVLKGIKPRLTYRVDNTLAKNGTQLGVELNFNSLEDFEPQNVVKQVEPL
RKLLEVRNKLADLRNKMGGNDKLEELLMDVLQNTEKLKTLGKEFGREAEVKDPSSDDRA
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcgaagaaggaaagcactcagcacaaactcgaccgcgttcgcgcgcctcgggttcat
atcacctacgacgtggacatcggcgatgccatcgagaaaaaggagctgcccttcgtcgtc
ggcgtactgggtgatttctccggcaacccgctggagccgctgcccaagctcaaggaccgc
aagttcgtgtacatcgaccgcgacaacttcaacggtgtgctcaagggtatcaagccacgc
ttgacctaccgcgtcgacaacaccctggccaagaacggcacccagctgggcgtggaactg
aacttcaacagcctcgaagacttcgagccacagaacgtggtcaagcaggtcgagccgctg
cgcaagctgctggaagtgcgcaacaagctggccgacctgcgcaacaagatgggcggcaac
gacaagctcgaagagctgctgatggatgtgctgcagaacaccgaaaagctcaagaccttg
ggcaaggagttcggccgtgaagccgaagtgaaagacccgtccagcgacgatcgcgcctga

DBGET integrated database retrieval system