KEGG   Pseudomonas putida DOT-T1E: T1E_2490
Entry
T1E_2490          CDS       T02181                                 

Gene name
hcpC
Definition
(GenBank) hcp protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx02025  Biofilm formation - Pseudomonas aeruginosa
ppx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    T1E_2490 (hcpC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    T1E_2490 (hcpC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppx02044]
    T1E_2490 (hcpC)
Secretion system [BR:ppx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   T1E_2490 (hcpC)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFO48335
UniProt: I7B008
Position
2732940..2733368
AA seq 142 aa
MPTPAYIKIIGQTQGNITAGAFTADSVGNVFQQGHEDQILVQEIKHEVTTPTDPQSGQPS
GQRVHKPFIFTSSLNKATPLMYQALATGEMLPTVEVSWYRTSSEGKQEHFFTTTLEDATI
VSINTVLPHALDKDNENYTRPL
NT seq 429 nt   +upstreamnt  +downstreamnt
atgccaacacccgcttacatcaagatcataggccagacccaaggcaacatcaccgcgggc
gccttcaccgctgactccgtcggcaacgtgttccaacaaggccatgaagatcagattctg
gttcaggaaatcaagcatgaggtgactacgcccactgacccccagagcggtcaaccgagt
ggccagcgcgtgcataagcctttcatattcaccagttcactgaacaaagctacccccctg
atgtatcaggcacttgccaccggcgaaatgctgccaacggtcgaggtcagctggtatcgc
acctcgtcggaaggcaaacaagagcattttttcaccaccacgctcgaagacgccaccatc
gtcagcatcaataccgtgcttccccacgcactcgacaaagacaatgaaaactacacccgg
ccgttgtag

DBGET integrated database retrieval system