KEGG   Pseudomonas putida DOT-T1E: T1E_3286Help
Entry
T1E_3286          CDS       T02181                                 

Gene name
ech1
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00071  Fatty acid degradation
ppx00280  Valine, leucine and isoleucine degradation
ppx00281  Geraniol degradation
ppx00310  Lysine degradation
ppx00360  Phenylalanine metabolism
ppx00362  Benzoate degradation
ppx00380  Tryptophan metabolism
ppx00410  beta-Alanine metabolism
ppx00627  Aminobenzoate degradation
ppx00640  Propanoate metabolism
ppx00650  Butanoate metabolism
ppx00903  Limonene and pinene degradation
ppx00930  Caprolactam degradation
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01120  Microbial metabolism in diverse environments
ppx01130  Biosynthesis of antibiotics
ppx01212  Fatty acid metabolism
Module
ppx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    T1E_3286 (ech1)
   00650 Butanoate metabolism
    T1E_3286 (ech1)
  Lipid metabolism
   00071 Fatty acid degradation
    T1E_3286 (ech1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    T1E_3286 (ech1)
   00310 Lysine degradation
    T1E_3286 (ech1)
   00360 Phenylalanine metabolism
    T1E_3286 (ech1)
   00380 Tryptophan metabolism
    T1E_3286 (ech1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    T1E_3286 (ech1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    T1E_3286 (ech1)
   00281 Geraniol degradation
    T1E_3286 (ech1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    T1E_3286 (ech1)
   00627 Aminobenzoate degradation
    T1E_3286 (ech1)
   00930 Caprolactam degradation
    T1E_3286 (ech1)
Enzymes [BR:ppx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     T1E_3286 (ech1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFO49122
UniProt: I7BY93
Position
complement(3622000..3622812)
Genome map
AA seq 270 aa AA seqDB search
MTEYSALKVELTDSVAHVQINRPEKVNAMNAAFWEEIVDIFQWIDDTDAVRAVVISGAGK
HFSAGIDLMMLASLAGQMGKDVGRNARFLRKTIQRLQASFTAVDTCRKPVLAAVQGYCIG
GAIDLISACDMRYCSSDAQFSIKEIDMGMAADVGTLQRLPRIIGDGIMRELAFTGRNVEA
DEALRIGLVNRVYDDQGALMDGVFAIAREIAAKSPIAVAGTKEMLSYMRDHRIDDGLDYI
ATWNAAMLQSEDLRVAVAAHMSKQKPTFAD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagtacagtgcattaaaggtcgaactgaccgacagcgtcgcccatgttcagatc
aatcgcccagagaaggtcaacgcgatgaatgcggccttctgggaggaaatcgtcgacatc
ttccagtggatcgatgacaccgatgccgtgcgcgcggtggtgatcagcggcgctggcaag
cacttttccgccggtatcgacctgatgatgctggcctcgctggctgggcagatgggcaag
gacgtgggccgcaatgcacgcttcctgcgcaagaccatccagcggctgcaggcctcgttc
actgctgtggacacgtgccgcaaacccgtactggcggccgtgcaaggctactgcatcggc
ggcgccatcgacctcatctcggcgtgcgacatgcgctactgcagcagtgacgcgcagttc
tcgatcaaggaaatcgacatgggtatggcggccgatgtcggcacattgcaacgtttgcca
cgcatcattggcgacggcatcatgcgggagctggcgtttaccgggcgcaatgtcgaggcc
gacgaggcgctgcgcatcggcctggtcaaccgagtctatgatgatcagggcgcactgatg
gacggcgtctttgccatcgcccgcgagattgccgcaaaatcgccgatcgctgtggccggc
accaaggaaatgctcagctacatgcgtgaccatcgcatcgacgatggcctggactacatt
gccacctggaacgccgcaatgctgcagtccgaagacctgcgcgtggcggtggcggcgcac
atgagcaaacagaaaccgacgttcgccgactga

DBGET integrated database retrieval system