KEGG   Pseudomonas putida DOT-T1E: T1E_3299Help
Entry
T1E_3299          CDS       T02181                                 

Gene name
yqeC
Definition
(GenBank) 6-phosphogluconate dehydrogenase-like protein
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00030  Pentose phosphate pathway
ppx00480  Glutathione metabolism
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01120  Microbial metabolism in diverse environments
ppx01130  Biosynthesis of antibiotics
ppx01200  Carbon metabolism
Module
ppx_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ppx_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    T1E_3299 (yqeC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    T1E_3299 (yqeC)
Enzymes [BR:ppx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     T1E_3299 (yqeC)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     T1E_3299 (yqeC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD 2-Hacid_dh_C F420_oxidored TrkA_N 3HCDH_N Sacchrp_dh_NADP ApbA NAD_binding_11 GFO_IDH_MocA UDPG_MGDP_dh_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AFO49135
UniProt: I7B261
Position
complement(3638223..3639206)
Genome map
AA seq 327 aa AA seqDB search
MQLGIIGLGRMGGNIARRLMRAGHRTVVHDRNREAITGLEGEGAQGAHDLGALVQKLKAP
RAVWVMLPAGDATEQTIAQLAELLEPGDAIIDGGNTFYKDDMRRAAELAKRGLHYLDVGT
SGGVWGLDRGYCMMIGGEKDVFERLEPLFKALAPGVGDIPRTHGRSGEHQRAEHGYIHAG
PPGAGHYVKMVHNGIEYGLMQAYAEGFDLLRSKGGNELPEDQRFDLNVAEIAEVWRRGSV
VTSWLLDLTADALVADPQLSQFSGSVSDSGEGRWTIDAAVEQAVPVPVLSSALFARFRSR
QQQGTYGDKILSAMRLGFGGHVEKKGE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgggaatcatcgggctgggccgtatgggcggcaatatcgcaaggcgcctgatg
cgcgccggtcaccgcaccgtggtgcacgaccgcaaccgtgaagccatcaccggcctggag
ggcgaaggcgcccagggcgcgcatgacctcggtgcactggtgcaaaagctgaaagcgccg
cgcgcggtctgggtgatgctgccggctggcgacgccaccgagcagactatcgcccagctg
gccgaattgctggaaccgggcgatgcgatcatcgacggtggcaacaccttctacaaggac
gacatgcgccgcgccgccgaactggccaagcgcggcctgcattatctggacgtcgggact
tccggcggcgtgtggggcctggaccgcggctactgcatgatgatcggcggcgaaaaggac
gtgttcgagcgcctcgagccgctgttcaaggcgctggcgccgggcgtgggcgacatcccg
cgtacccatggccgcagcggcgagcaccagcgtgccgagcacggctacatccacgctggc
ccacccggcgccgggcactacgtgaaaatggtgcataacggcatcgagtacggcctgatg
caggcctatgccgaaggcttcgacctgctgcgcagcaagggcggcaacgagctgcccgaa
gaccagcgcttcgacctgaacgtggccgaaattgccgaagtgtggcgacgcggcagcgtg
gtgacctcgtggctgctcgaccttaccgccgatgcgctggtggccgaccctcagctgtcg
caattcagtggctcggtgtccgacagtggcgaaggccgctggaccatcgacgccgccgtc
gagcaggcggtgccggtgccggtgttgtccagcgcactgttcgcgcgcttccgctcgcgc
cagcaacagggcacctacggtgacaagatcctctcggccatgcgcctgggcttcggtggc
cacgtcgagaagaaaggcgaatga

DBGET integrated database retrieval system