KEGG   Pseudomonas putida DOT-T1E: T1E_3541Help
Entry
T1E_3541          CDS       T02181                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independ
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00625  Chloroalkane and chloroalkene degradation
ppx00680  Methane metabolism
ppx01100  Metabolic pathways
ppx01120  Microbial metabolism in diverse environments
ppx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    T1E_3541
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    T1E_3541
Enzymes [BR:ppx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     T1E_3541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YtfJ_HI0045
Motif
Other DBs
NCBI-ProteinID: AFO49377
UniProt: I7BYX9
Position
complement(3886332..3886541)
Genome map
AA seq 69 aa AA seqDB search
MHSSHTGQIATKHYNRQLMQAIMWDRINIAELVGVQVINLDQAPEGYGEFDAGVPKKFVI
DPHKMWGAA
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
ttgcacagctcccacaccggccagatagcgaccaagcattacaaccgccagctgatgcag
gcgatcatgtgggaccgcatcaacattgctgaattggtgggggtgcaggtgatcaacctg
gatcaggcgccggaagggtatggcgagtttgatgcaggtgtgccgaagaaattcgttatc
gacccgcacaaaatgtggggtgcggcgtaa

DBGET integrated database retrieval system