KEGG   Pseudomonas putida DOT-T1E: T1E_3645Help
Entry
T1E_3645          CDS       T02181                                 

Gene name
cobQ
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00860  Porphyrin and chlorophyll metabolism
ppx01100  Metabolic pathways
Module
ppx_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    T1E_3645 (cobQ)
Enzymes [BR:ppx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     T1E_3645 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 CLP1_P
Motif
Other DBs
NCBI-ProteinID: AFO49481
UniProt: I7C8Q4
Position
complement(4005508..4006962)
Genome map
AA seq 484 aa AA seqDB search
MTTLMVQGTTSDAGKSTLVTALCRWLLRQGVAVVPFKPQNMALNSAVTADGGEIGRAQAV
QAQACRLQPHTDMNPVLLKPNSDTGAQVIIHGRAVTSMNAVAYHDYKTTAMQAVLASHQR
LSAAYPVVMVEGAGSPAEINLRAGDIANMGFAEAVDCPVILVADINRGGVFAHLVGTLEL
LSTTEQARVKGFVINRFRGDIALLQPGLDWLEQRTGKPVLGVLPYVTDLHLEAEDGIDVR
QGVKHARVLKVIVPVLPRISNHTDFDPLRLHPQVDLQFIGPGQPIPAADLIILPGSKSVR
GDLAQLRERGWDKAIERHLRYGGKLIGICGGLQMLGREVHDPLGLEGAAGSSQGLGLLDY
ATVLEAEKQLRNVAGTLSLEAATVTGYEIHAGVTTGPALAQPAVQLADGRHDGAVSADGQ
ILATYLHGLFEGSQSCAALLRWAGLEDVQAIDYEALREHDIERLADLVEKHLDTAQLRQL
CGVA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccctcatggtgcaaggcaccacctccgacgcaggcaagagcacactggtgacc
gcattgtgccgctggctgttgcgccagggcgtcgctgtggtgcccttcaagccacagaac
atggcgctgaacagcgcggtgacggctgatggcggggaaatcggccgtgcccaggcggtg
caggcccaggcctgccggctacaaccgcacaccgacatgaacccggtgctgctcaagccc
aacagcgacaccggcgcccaggtcatcatccacggtcgcgcggtcaccagcatgaatgca
gtggcctaccacgactataaaaccacggccatgcaagcggtgctggcgtctcaccaacgc
ctgagtgccgcgtacccggtggtcatggtcgagggtgcggggtcgccggcagagatcaac
ctgcgtgccggcgatatcgccaacatgggctttgccgaagcggtggactgcccggtgatc
ttggtggccgacatcaaccgcggtggtgtgttcgcccatctggtgggcacgctggaactg
ctgtcgaccactgaacaggcgcgggtcaaaggttttgtcatcaaccgcttccgtggcgat
atcgccctgctgcagccagggctggactggctggaacaacgcaccggcaaaccggtactg
ggcgtactgccttacgttaccgacctgcacctggaagccgaagacggtatcgatgtgcgt
caaggcgtcaagcacgcgcgtgtgctcaaggtgatcgtgccagtgctgccgcgtatcagt
aaccacaccgatttcgacccgctgcgcctgcacccgcaggtggacttgcagttcatcggc
cctggccagccgattccggctgccgacctcatcatcttgccgggctccaagagcgtgcgg
ggcgacttggcacaactgcgcgagcgcggttgggacaaggccatcgagcggcacctgcgc
tatggcggcaagctgatcggtatctgcggtggcctgcagatgctggggcgggaagtgcat
gacccgctggggctggagggggccgcaggctctagccaggggctcggcctgctcgactat
gccacggtgctcgaagccgagaagcaactgcgcaatgtggccggcacgctgagccttgaa
gcggcaacggtaaccggttatgaaattcatgctggcgttacgacggggcctgcgctggcg
caacccgcggtccaactggctgatggccgccatgatggcgctgtcagtgccgatggccag
atcctcgccacctacctgcatggcctgttcgaaggcagccagtcgtgtgccgcgctattg
cgctgggccgggctggaggatgtgcaggctatcgactacgaagcgttgcgcgaacacgac
atcgagcgcctggccgatctggtggagaagcacctggacaccgcgcagttgcgccagctg
tgtggggtagcctga

DBGET integrated database retrieval system