KEGG   Pseudomonas putida DOT-T1E: T1E_4265
Entry
T1E_4265          CDS       T02181                                 

Gene name
todF
Definition
(GenBank) 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase
  KO
K10702  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [EC:3.7.1.25]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00622  Xylene degradation
ppx01100  Metabolic pathways
ppx01120  Microbial metabolism in diverse environments
ppx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00622 Xylene degradation
    T1E_4265 (todF)
Enzymes [BR:ppx01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.25  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase
     T1E_4265 (todF)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Abhydrolase_4 Peptidase_S9 baeRF_family5
Other DBs
NCBI-ProteinID: AFO50094
UniProt: I7CDY3
Position
4641242..4641691
AA seq 149 aa
MGAVGVSFELTDGLDAVWGYEPSVPNMRKVMDYFAYDRSLVSDELAELRYKASTRPGFQE
AFASMFPAPRQRWVDALASSDQDIRDIRHETLILHGRDDRVIPLETSLRLNQLIEPSQLH
VFGRCGHWVQIEQNRGFIRLVNDFLAAED
NT seq 450 nt   +upstreamnt  +downstreamnt
atgggtgccgttggcgtgagcttcgagctcacggatggactggatgcagtttggggttat
gagccgtccgtgccgaacatgcgcaaggtcatggactacttcgcctacgaccgaagtctc
gtttccgacgaactggcggaactgcgctacaaggcgagcacccggcccggttttcaggag
gccttcgcttccatgttccctgctccgcggcagcgctgggtagatgcgctggccagttcc
gatcaggacatccgggacatccggcatgaaacgctgatcctgcatggccgcgacgatcgc
gtgattcccctcgaaacctcgttgcggctgaaccagctgatcgaaccctcccagttacat
gtctttggcaggtgtggccattgggtgcagatcgagcaaaaccggggctttatccgcttg
gtcaacgattttcttgccgcggaggactga

DBGET integrated database retrieval system