KEGG   Pseudomonas putida DOT-T1E: T1E_4270
Entry
T1E_4270          CDS       T02181                                 

Gene name
tobD
Definition
(GenBank) Cis-1,2-dihydrobenzene-1,2-diol dehydrogenase
  KO
K16269  cis-1,2-dihydrobenzene-1,2-diol/chlorobenzene dihydrodiol dehydrogenase [EC:1.3.1.19 1.3.1.119]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00361  Chlorocyclohexane and chlorobenzene degradation
ppx00362  Benzoate degradation
ppx00623  Toluene degradation
ppx00624  Polycyclic aromatic hydrocarbon degradation
ppx00643  Styrene degradation
ppx01100  Metabolic pathways
ppx01120  Microbial metabolism in diverse environments
ppx01220  Degradation of aromatic compounds
Module
ppx_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    T1E_4270 (tobD)
   00361 Chlorocyclohexane and chlorobenzene degradation
    T1E_4270 (tobD)
   00623 Toluene degradation
    T1E_4270 (tobD)
   00643 Styrene degradation
    T1E_4270 (tobD)
   00624 Polycyclic aromatic hydrocarbon degradation
    T1E_4270 (tobD)
Enzymes [BR:ppx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.19  cis-1,2-dihydrobenzene-1,2-diol dehydrogenase
     T1E_4270 (tobD)
    1.3.1.119  chlorobenzene dihydrodiol dehydrogenase
     T1E_4270 (tobD)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3Beta_HSD Epimerase
Other DBs
NCBI-ProteinID: AFO50099
UniProt: I7CDY7
Position
4645375..4646202
AA seq 275 aa
MRLEGEVALVTGGGAGLGRAIVDRYVAEGARVAVLDKSAAGLEALRKLHGDAIVGVEGDV
RSLDSHREAVARCVEAFGKLDCLVGNAGVWDYLTQLVDIPDDLISEAFEEMFEVNVKGYI
LAAKAALPALYQSKGSAIFTVSNAGFYPGGGGVLYTAGKHAVIGLIKQLAHEWGPRIRVN
GIAPGGILGSDLRGLKSLDLQDKSISTFPLDDMLKSVLPTGRAATAEEYAGAYVFFATRG
DTVPLTGSVLNFDGGMGVRGLFEASLGAQLDKHFG
NT seq 828 nt   +upstreamnt  +downstreamnt
gtgagacttgaaggcgaagtggccttggtgacaggcggtggcgcaggcctgggcagagcg
atcgtggatcgttatgtcgcggaaggtgcgcgtgtcgcggtgctggataaatccgcggca
ggcctggaagcgctcaggaaactccatggcgatgcaatcgtgggcgtggagggggatgtt
cgctcgctcgacagccatcgtgaggctgtggcccgctgcgtcgaagcgttcggcaagctg
gactgcctggttggcaatgctggcgtttgggactacctgacccaactggtggatattccc
gacgacctcatatcggaggcattcgaggaaatgttcgaggtcaatgtcaagggctacatc
ctggcggcaaaggctgcgctacctgcgctttatcagagcaaaggcagcgcgatattcact
gtgtcgaatgccggtttctacccgggcggtggcggtgttctgtatacagctggcaaacat
gccgtgattggattgatcaagcagctcgcgcacgaatgggggccgcgtatccgcgtcaac
ggcatcgcccccggtggcattttggggagcgatctgcgcgggctgaagagccttgattta
caagacaagagcatttcgacctttccattggacgacatgctgaaatccgttcttccgacc
gggcgggccgccactgccgaggaatacgccggcgcctatgtcttcttcgcgacgcgcggc
gacacggttccgctcaccggtagcgtgttgaacttcgatggcggcatgggcgtgcgtggc
ttgttcgaagccagcctaggcgcacagctcgacaagcacttcggttga

DBGET integrated database retrieval system