KEGG   Pseudomonas putida DOT-T1E: T1E_5163Help
Entry
T1E_5163          CDS       T02181                                 

Definition
(GenBank) Putative RNA 2'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ppx  Pseudomonas putida DOT-T1E
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppx03009]
    T1E_5163
Enzymes [BR:ppx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     T1E_5163
Ribosome biogenesis [BR:ppx03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    T1E_5163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AFO50986
UniProt: I7CCM5
Position
complement(5617094..5618158)
Genome map
AA seq 354 aa AA seqDB search
MNTLFMHCRPGFEGEVCAEISEHAARLGVAGYAKGKPQSASAEFVCSEEGGAERLMGELR
FNQLIFPRQWARGGYVELPESDRISVLLAQLADFPVFGSLWLEVLDSNEGKELSTFCRKF
EVPLRKALEKAGRLVDDPGRPRLLLTFISGRRVFVGVASASNSALWPMGIPRLKFPREAP
SRSTLKLEEAWHQFIPREQWEQRLGDDMTGVDLGASPGGWTYQLVRRGMLVTAIDNGPMA
ESLMDTGLVQHLMADGFTWQPKQPVDWMVCDIVEKPARTTSLIETWLGEGLCREAVVNLK
LPMKQRYAEVRRLLDRMEATFKARKIKVSIACKQLYHDREEVTCHLRRLDLKPR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaataccctgttcatgcattgccggcccggtttcgagggcgaggtttgcgccgaaatc
agcgaacatgccgcccgcctgggtgttgccggctatgccaaaggcaagccgcaaagtgcc
agtgccgagtttgtctgtagcgaggagggcggtgccgagcgcttgatgggggaactgcgt
ttcaaccagctgattttcccgcggcagtgggcacgtggcggttacgtcgaactgccggaa
agtgaccgcatcagcgtactgctggcgcagttggctgacttcccggtgttcggtagcctt
tggctggaggtgctggacagcaacgaaggcaaggaattgtccaccttctgccgaaagttc
gaagtgccgttgcgcaaggccctggagaaggccggccgcctggtcgacgaccctggccgc
ccacgcttgctgctgaccttcatcagcggccggcgggtatttgtcggtgttgcatcggcc
agcaacagcgccttgtggcccatgggcatcccacgcctgaagttccctcgtgaggcacct
agccgttcgacactcaagctggaagaagcctggcaccagttcattccgcgtgagcagtgg
gagcagcgcctgggggatgacatgaccggcgtcgacctgggagcctcaccgggtggctgg
acctaccagctggtgcgccgtggcatgctggtgacagccatcgataacgggccgatggcc
gaaagcctgatggacacaggcctggtccagcacttgatggccgatgggtttacctggcag
ccgaagcagccggtagactggatggtgtgcgatatcgtcgagaagccggcgcgtaccacc
tcgctgattgaaacctggctgggtgaggggctgtgccgcgaggcggtggtcaacctgaag
ttgccgatgaagcagcgttatgccgaagtacggcgcctgctcgaccgtatggaggcaaca
ttcaaggcacgcaagatcaaggtgtcgattgcctgcaagcagctgtaccacgaccgtgaa
gaagtaacctgccacctgcggcggctcgacttgaagccccgctga

DBGET integrated database retrieval system