KEGG   Pseudomonas putida DOT-T1E: T1E_5535Help
Entry
T1E_5535          CDS       T02181                                 

Definition
(GenBank) DcaF
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00071  Fatty acid degradation
ppx00072  Synthesis and degradation of ketone bodies
ppx00280  Valine, leucine and isoleucine degradation
ppx00310  Lysine degradation
ppx00362  Benzoate degradation
ppx00380  Tryptophan metabolism
ppx00620  Pyruvate metabolism
ppx00630  Glyoxylate and dicarboxylate metabolism
ppx00640  Propanoate metabolism
ppx00650  Butanoate metabolism
ppx00900  Terpenoid backbone biosynthesis
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01120  Microbial metabolism in diverse environments
ppx01130  Biosynthesis of antibiotics
ppx01200  Carbon metabolism
ppx01212  Fatty acid metabolism
ppx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    T1E_5535
   00630 Glyoxylate and dicarboxylate metabolism
    T1E_5535
   00640 Propanoate metabolism
    T1E_5535
   00650 Butanoate metabolism
    T1E_5535
  09103 Lipid metabolism
   00071 Fatty acid degradation
    T1E_5535
   00072 Synthesis and degradation of ketone bodies
    T1E_5535
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    T1E_5535
   00310 Lysine degradation
    T1E_5535
   00380 Tryptophan metabolism
    T1E_5535
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    T1E_5535
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    T1E_5535
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    T1E_5535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppx04147]
    T1E_5535
Enzymes [BR:ppx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     T1E_5535
Exosome [BR:ppx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   T1E_5535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AFO51356
UniProt: I7CDK3
Position
6036549..6037751
Genome map
AA seq 400 aa AA seqDB search
MLDAYIFAGLRTPFGRHGGALAAVRPDDLAAHVIRELLARHAIPGDAIEDVILGNTNQAG
EDSRNIARHAALLAGLPVTVPGQTVNRLCASGLAAVIDAARAVTCQEGELFVAGGVESMS
RAPFVMAKAEAAYSRDFSVYDSTIGARFPNPKIVSEFGNDSMPQTGDNVAQEYGIGREHA
DLFAARSQANYEAARASGFFDDELLSVSVPTGRKTPPNLVDHDEHPRPQSDIAALSRLRP
LQEGGVVTAGNASGVNDGAAALLIGTSAAGERHGLVPMARILSSAAAGVAPRIMGVGPVE
AINKALARAGLTLADMDIIEINEAFASQVLGCLKGLGLAFDDPRVNPNGGAIAVGHPLGA
SGARLALSTARALQHSVKRYAVVSLCIGVGQGLAIVIERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgcttatatctttgcggggttgcgtacgcccttcggccgccacggtggtgca
ctggctgcggtgcgaccagacgatctcgctgcccatgtgatccgggaattgctggcacgg
cacgccatccctggtgacgccatcgaggacgtgatcctcggcaacaccaaccaggcgggt
gaggacagccgcaatatcgcgcgccacgcagcgctgcttgccggattaccggtaacggtt
ccgggccagacggtcaataggttgtgcgccagtggtttggcagcggtcatcgatgccgcc
cgtgcggtcacctgtcaggaaggtgaactgttcgtggccggcggggtggaaagcatgtcg
cgtgcgcctttcgtcatggcaaaagcagaggcggcttatagccgagacttttcggtgtat
gacagtacgatcggcgcgcgctttccgaatccgaagatcgtttcggagtttggcaatgac
agcatgccgcagactggcgacaacgtagctcaggagtacggtattgggcgggagcacgct
gacctcttcgcggcccgctcgcaggccaactacgaagccgcgcgcgctagcggtttcttc
gacgacgagttattgagtgtcagcgtgccgactggccgcaagacgcccccaaaccttgtg
gatcatgatgaacacccgcggccacaatctgacattgcggccttgagtcgcctgcggcct
ttgcaggaagggggtgtagtcaccgctggcaatgcctcaggtgtcaacgatggtgccgcc
gctctactgatcggcacgtcggctgcaggagaacgtcacggtttggtgcccatggcacgc
attctttctagcgcggctgcgggcgtggcgccgcgcatcatgggtgttggtccggttgag
gcaatcaacaaagccttggcgcgtgccggcctgacactggcggacatggatatcatcgaa
atcaatgaagcatttgccagccaggtgctgggttgcctgaaaggtttggggctcgccttc
gatgatccgcgggtcaaccccaacggtggcgcgattgcggtggggcatcccttgggcgct
tccggtgcgcgcctggcgctgagcacggcgcgggcactgcagcacagtgttaagcggtac
gccgtggtgagcctgtgtatcggggtcggccaagggctggcaatagttatcgaacgcgtg
taa

DBGET integrated database retrieval system