KEGG   Paenibacillus polymyxa E681: PPE_00033Help
Entry
PPE_00033         CDS       T01319                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00900  Terpenoid backbone biosynthesis
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01130  Biosynthesis of antibiotics
Module
ppy_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PPE_00033 (ipk)
Enzymes [BR:ppy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PPE_00033 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADM67935
UniProt: E0RM43
Position
35600..36454
Genome map
AA seq 284 aa AA seqDB search
MKIYEKAPAKINLMLDVLRKRDDGYHEVEMIMTMVDLSDRLTMSELPRDTIIISSQAGYI
PLDEKNLAFQAARLIKERYNVSTGVHIHLDKHIPVAAGLAGGSSDAAAALRGLNKLWKLG
ISDAELRVLGAELGSDVPFCITGGTALASGRGELLKPLPNPPQCWVILAKPPINVSTAEV
YGRVKADQITHHPSARQMEHAIRNASFTDVCNALGNVLEDVTLKLYPEVEHLKSSMIRLG
ADGVLMSGSGPTVFGLVSKEAKVPRIYNGLRGFCKDVYAVRLLT
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatatatgaaaaagcaccggcgaaaatcaatttaatgcttgatgttctacgtaag
cgggacgatggttatcacgaggtcgaaatgattatgaccatggtcgatctgtctgaccga
ttgacgatgtctgagttaccgcgtgataccattattatttcaagtcaagccgggtacata
ccattagatgaaaagaacttggcttttcaggctgcgcgtctgatcaaagaacgttataac
gtgtctacaggcgtccacatccatctggataagcatatcccggtggcggcagggttggcg
ggtggaagtagtgatgctgccgcagcgctgcgtggactgaacaagctatggaagcttggc
atctcggatgcagaattaagggtgctgggtgctgagctgggctcagatgtacctttctgt
attacagggggtacagctttagcgagcggacgcggagaactgctcaagccacttccgaat
ccgccacaatgctgggtgatccttgcgaagccgccgattaatgtatcgacggctgaagtg
tatggtcgtgtcaaagcagaccagattacgcaccacccgtctgcccgccagatggagcat
gcgatccgtaacgcttcttttaccgatgtatgcaacgcgctggggaatgtacttgaggat
gtaacactaaagctgtatccagaggtagagcatcttaaaagctccatgatccgcttaggg
gcagatggtgtgctgatgtcaggtagtggacctacagtgttcggactagtatcgaaggaa
gccaaagtgccacgaatttacaatggactaagagggttttgtaaagatgtatatgcagta
cgacttttgacctga

DBGET integrated database retrieval system