KEGG   Paenibacillus polymyxa E681: PPE_00197Help
Entry
PPE_00197         CDS       T01319                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00010  Glycolysis / Gluconeogenesis
ppy00051  Fructose and mannose metabolism
ppy00562  Inositol phosphate metabolism
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01120  Microbial metabolism in diverse environments
ppy01130  Biosynthesis of antibiotics
ppy01200  Carbon metabolism
ppy01230  Biosynthesis of amino acids
Module
ppy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ppy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_00197 (tpiA)
   00051 Fructose and mannose metabolism
    PPE_00197 (tpiA)
   00562 Inositol phosphate metabolism
    PPE_00197 (tpiA)
Enzymes [BR:ppy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PPE_00197 (tpiA)
Exosome [BR:ppy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PPE_00197 (tpiA)
  Exosomal proteins of bladder cancer cells
   PPE_00197 (tpiA)
  Exosomal proteins of melanoma cells
   PPE_00197 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADM68080
UniProt: E0RAG7
Position
220503..221255
Genome map
AA seq 250 aa AA seqDB search
MRTPIIAGNWKMFKTVPEAKTFIEEIKGKAEVAGVESVICAPFTNLPALVEAVKGTSIKI
GAQNLHFAEDGAFTGEISGGMLKDLGVDYVVIGHSERREYFNETDETVNKKVHAAFRHGL
TPIVCVGEKLEDREAGQTKEVVKVQTVAAFAGLAKDQAAQVVVAYEPIWAIGTGKSSTSQ
DANEVISYIRSLIKELYDENTANAVRIQYGGSVKPENVTEYLGQSDIDGALVGGASLQPA
SYIALVEGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgagaacaccgattatcgcgggtaactggaagatgtttaaaaccgtaccagaagctaaa
actttcatcgaagagatcaaaggcaaagcagaggttgcaggagtggaaagcgtgatttgc
gcaccatttacgaatcttcctgctctggttgaagcagtaaaaggcacgtctattaaaatt
ggcgcacaaaacctgcactttgcagaagatggcgcatttacaggtgaaattagcggtgga
atgctgaaagatctgggcgtagactacgttgtgatcggacactccgagcgtcgtgaatat
tttaatgaaacagacgaaacggtgaacaaaaaggttcatgcggcattccgtcatggcctg
actccaatcgtatgtgtaggcgaaaagttggaagatcgtgaagctggacaaaccaaagag
gttgtaaaagtgcaaactgtagcagcttttgctggtttggctaaggatcaggctgcacaa
gtagttgttgcttatgagccaatctgggccatcggaacaggcaaatcctccacttcgcag
gatgcgaatgaagtgatttcctatatccgtagtctgattaaagagctgtatgatgaaaat
acagcaaatgctgtacgtattcagtatggtggcagtgtaaaacctgaaaatgttactgag
tacctgggtcaaagcgatatcgacggcgcgctcgtgggcggtgccagtcttcaaccggcg
tcgtacatcgcgcttgttgagggggcgaagtaa

DBGET integrated database retrieval system