KEGG   Paenibacillus polymyxa E681: PPE_00923Help
Entry
PPE_00923         CDS       T01319                                 

Definition
(GenBank) beta-1,6-glucanase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00511  Other glycan degradation
ppy00600  Sphingolipid metabolism
ppy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PPE_00923
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PPE_00923
Enzymes [BR:ppy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PPE_00923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydr_30_2 DUF1510
Motif
Other DBs
NCBI-ProteinID: ADM68773
UniProt: E0RIS0
Position
1006716..1008233
Genome map
AA seq 505 aa AA seqDB search
MKKLQKQRRTDIWLLIAAAAILVCAVLASMTIRNAPGPKAENNVNMWLTTPDPANRLTQQ
TPIRWDKDNSKENAANADTLTIEIKPDIHYQTIEGFGAAVSGSSAYLMNHGLSANQRDRL
LNDLFTASGIQLSYIRHTIGASDYSVDEQGQPGSYTYDDVATGKDYELNHFSIAKDRDVI
DVLKQILRRNQDLKIMGTPWTAPPWMKYGEQIYNGWYLDYTDSRVYQAYADYFVRYLQAY
ANEGIPIQAISIQNEPEFTTSKYPSMSMGAAEQANFIKQYLGPTLNRNHLSTHIIAFDHN
WDTGSEYAKTVLGNEQARSYTHGTAFHCYKGEPTAMTDVHHAFPDKPVYMTECSGGAWSL
GFGDDLSWDMSKLIIGAPRNWSQNVLFWNIALDPSGGPTNGGCDNCRGVVTIDPLSGAVT
KNVEYYAIGHASKFVRPGAVRIDSTHYSGSIETVAYRNPDGTLVLIAANTGENTKTFKVR
QGNKVFKSTLPSKSAATFQWNPTVS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactccaaaagcaacgacgtactgacatctggctgcttatagctgcagcagcc
attttggtctgtgcggtcctggccagtatgactatacggaatgctccggggccgaaagca
gaaaataacgtcaacatgtggctaacaacacccgatccggcgaatcgcctaacccaacaa
accccgatccgttgggataaggataacagtaaagaaaatgctgcgaatgcggatacactg
acgattgagattaagccagatatccattatcagacgatagagggatttggcgcagcggtg
tccggttcgtctgcatacctgatgaatcatggcttgtctgccaatcagcgtgatcggctg
ctaaatgatttgtttacagccagtggcattcaactgagttatattcgccataccattgga
gcctcagattattccgtagatgaacagggacagcctggcagctatacctatgacgatgtg
gcaacaggcaaggactatgagctgaatcatttctccatcgccaaggatcgggatgtgatc
gatgtgctgaagcaaatcttgagaagaaaccaggatttaaaaattatgggaaccccatgg
acagctccgccctggatgaaatatggggagcagatttataacggctggtatttggactat
accgattcgcgcgtctaccaggcgtatgctgactattttgttcgttacctacaggcttat
gcgaacgaagggattccgattcaggcgatttccattcaaaatgagccagaattcacgacg
tccaagtatcccagcatgagcatgggagcagcagaacaggcgaattttattaaacaatat
ctgggcccgaccctaaatcgaaaccatttatctactcacattattgcctttgaccataac
tgggatacagggagcgaatatgccaagaccgtgttaggaaatgaacaggctcgaagctat
acgcacggaacggcctttcattgctacaaaggagagcccacagcgatgacagatgtgcat
catgctttccctgataagcctgtatatatgacagaatgtagtgggggagcgtggagtctg
ggcttcggagatgatttgagctgggacatgtccaagctgatcattggtgcaccccgaaac
tggtcgcaaaatgtcctcttttggaatatcgcacttgacccgtccgggggtccgaccaat
ggggggtgcgacaactgtagaggtgtagtgaccatcgacccgttaagcggtgcagttacg
aaaaatgtggagtactatgcgattgggcacgccagcaaatttgtccgtccaggtgcggta
cgtattgattctacacattatagtggaagtatcgaaacggtcgcttatcgcaaccccgac
ggtacgcttgtcctgattgccgccaatacgggagagaacacaaagacatttaaggttcgg
cagggaaataaggttttcaaatctacccttccatccaagtccgcagctacctttcaatgg
aatcctacggtttcctga

DBGET integrated database retrieval system