KEGG   Paenibacillus polymyxa E681: PPE_02530Help
Entry
PPE_02530         CDS       T01319                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00010  Glycolysis / Gluconeogenesis
ppy00020  Citrate cycle (TCA cycle)
ppy00620  Pyruvate metabolism
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01120  Microbial metabolism in diverse environments
ppy01130  Biosynthesis of antibiotics
ppy01200  Carbon metabolism
Module
ppy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_02530
   00020 Citrate cycle (TCA cycle)
    PPE_02530
   00620 Pyruvate metabolism
    PPE_02530
Enzymes [BR:ppy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PPE_02530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H ATP-synt_ab_Xtn Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADM70360
UniProt: E0RAQ1
Position
complement(2790492..2792105)
Genome map
AA seq 537 aa AA seqDB search
MAKFEYKFPELGEGLHEGEIIKMHIKPGDKVTDEDIIMEVQNDKAVVEVPCPVNGTVQEV
FAKDGDIFNVGQVVAVIDAEGELPEQEDAPEAPAASPEPSAAAQGGAAGAARFEYKFPEL
GEGLHEGEIIKMHIKPGDKVTDEDIIMEVQNDKAVVEVPCPVNGTVQEVFAKDGDIFNVG
QVVAVIAAEGELPEQEEAPAAAKQEQDAAQGGANTKPAATPAASNKDVLATPSVRKFARE
QGVNIAQVNGSGKNGKITKEDVEAFKNGGGQAAAPVAKEAAKAQEPAKKEAKAAASSAPA
ADPRAEEERVPFKGIRKAISNAMVKSAYTAPHVTIMDEVDVTELVAFRTRIKPIAEKKGT
KVTYLPFIVKALVAASRQFPALNATIDEEANEIVYKKYYNIGIATDTDNGLIVPVIKDAD
RKSIWMIADSIRDLAVRGRDGKLAANEMRGSTISITNIGSAGGMFFTPIINFPEVAILGT
GRISEKAVVKNGEIVAAPVMALSLSFDHRIIDGATAQNFMNYIKQLLANPELLVMEV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaatttgaatataaattcccggagctaggtgaaggtcttcacgaaggcgaaatc
atcaagatgcacatcaagcccggtgacaaagtaacagatgaagatatcatcatggaagta
caaaacgataaggcagtagttgaagttccttgtccggttaatggtacagtacaagaagta
tttgccaaagacggcgacatctttaacgttggtcaagtcgtagctgtaattgatgcagaa
ggtgaacttcctgaacaagaagatgcaccagaagcaccagctgctagccctgaaccaagt
gctgctgcacaaggcggagctgcaggtgcagctagatttgaatataaattcccagagctg
ggtgaaggtcttcacgaaggcgaaatcatcaagatgcacatcaagcccggtgacaaagta
acagatgaagatatcatcatggaagtacaaaacgataaggcagtagttgaagttccttgt
ccggtcaatggtacagtacaagaggtatttgccaaagacggcgacatctttaatgtaggt
caagtcgtagctgtaatcgctgcagagggtgaacttcctgagcaagaagaagcaccagct
gctgctaaacaagaacaggatgctgcacaaggcggagctaacactaaaccagctgcaact
cctgctgcttctaacaaagacgtgctggctacacctagcgtccgcaaatttgcacgtgag
caaggtgtgaacattgctcaggtgaatggctccggcaaaaatggtaaaatcaccaaagaa
gatgtagaagctttcaaaaatggtggaggtcaagcggctgcaccagtggcgaaagaagct
gcaaaagcacaagagcctgctaagaaagaagcgaaagctgcagcatcatccgcaccagca
gctgatccacgtgctgaggaagagcgcgtaccatttaaaggtatccgcaaggctatttcc
aatgctatggttaaatcggcttatacggctccgcacgttacgattatggatgaagtagat
gtaactgaactggttgctttccgtactcgtatcaaaccaattgctgagaagaaaggcaca
aaagtaacatacctgccattcatcgtaaaagctttggttgctgcttcccgtcaattcccg
gctctgaatgccacaatcgatgaagaagcaaacgaaattgtctacaaaaaatactacaac
atcggtatcgctacagatacagacaacggcttgatcgttcctgttatcaaagatgctgat
cgtaagagtatctggatgattgctgattccattcgtgatctggctgtgcgcggtcgtgat
ggaaaattggctgcgaatgagatgagagggagcacaatctccatcactaacatcggttcc
gcaggcggtatgttctttactccaatcattaacttccctgaagttgcgattttgggtact
ggccgcatcagtgaaaaagcagtcgtgaaaaacggtgaaattgtagctgctccagtaatg
gctctttccttgagctttgaccaccgtattattgacggtgcaactgctcaaaacttcatg
aactatatcaaacagctgctcgctaaccctgagttgcttgttatggaggtgtaa

DBGET integrated database retrieval system