KEGG   Paenibacillus polymyxa E681: PPE_02799Help
Entry
PPE_02799         CDS       T01319                                 

Definition
(GenBank) ferredoxin
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00010  Glycolysis / Gluconeogenesis
ppy00020  Citrate cycle (TCA cycle)
ppy00620  Pyruvate metabolism
ppy00640  Propanoate metabolism
ppy00650  Butanoate metabolism
ppy00680  Methane metabolism
ppy01100  Metabolic pathways
ppy01120  Microbial metabolism in diverse environments
ppy01130  Biosynthesis of antibiotics
ppy01200  Carbon metabolism
Module
ppy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_02799
   00020 Citrate cycle (TCA cycle)
    PPE_02799
   00620 Pyruvate metabolism
    PPE_02799
   00640 Propanoate metabolism
    PPE_02799
   00650 Butanoate metabolism
    PPE_02799
  Energy metabolism
   00680 Methane metabolism
    PPE_02799
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PPE_02799
Enzymes [BR:ppy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PPE_02799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4_7 Fer4 Fer4_16 Fer4_10 Fer4_6 Fer4_2 Fer4_17 Fer4_9 Fer4_4 Fer4_21 Fer4_8 Fer4_3 Fer4_19
Motif
Other DBs
NCBI-ProteinID: ADM70626
UniProt: E0RD91
Position
complement(3056541..3057554)
Genome map
AA seq 337 aa AA seqDB search
MSILTRTNRLGFFEIRLESIGGLGANLAGKMLAETGVLGLGLNASNFSSYGSEKKGTPVK
SFVRFCEPEVDIRDHSPIEQPHVVGIFHETLYKTVNVISGLPADGIVVVNSTRPAEEIRA
DLGLVSGTLAVVDAMGIALEERTKLNTSMLGALFRVCDFLDPEAMRSVIRSTFEKKNPLL
VEPNLRTFNRGYDEMELHVYPVTDDAEDRVFERPQPLLGYETQLLGGVIATQGNSMTRDV
SGSRQGYVPEYEADKCTHCAKCDSICPDYCFVWEEQADKRGRMMPFLQGIDFQYCKGCLK
CVDICPSGALSSRREQWGWAEQNRVAHQFPAYEGGRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgtctattttaacgcgcacaaatcgactcggattttttgaaatccggctggaatccatt
ggtggactcggcgctaatctggctggcaaaatgttggccgaaaccggggtgctgggtctg
gggctgaatgcttcaaatttttcgtcctacggttcggaaaaaaagggaactccggttaaa
agcttcgtccgcttctgtgagccggaggtcgatattcgggatcacagtccgattgagcaa
ccgcatgtggtaggcattttccatgaaacgttatacaaaacagtaaatgtaatcagcgga
ctgccagcggatgggattgtagtggttaattccacgcgtccagcagaagaaatacgggct
gatttgggactggtatccggtacattagcggtggtggatgcgatgggcatcgcactggaa
gagcgaaccaaactaaatacgtccatgctcggtgccttgttccgtgtctgtgatttcctg
gacccggaagcgatgagatcggttatacgcagtacctttgaaaagaaaaatccactgtta
gtggaacctaatctgcgtacgtttaaccgtggttatgatgaaatggaactgcacgtatat
ccggttactgatgacgcagaggatcgggtttttgaacgtccgcagccattgctgggatac
gaaacccaactactggggggcgttattgcaactcagggaaacagtatgacgagagatgtt
agtggttcacgtcaggggtatgtgcctgaatatgaagctgataaatgtacccattgtgcc
aagtgtgattcgatttgcccggattactgttttgtatgggaagagcaagcagacaaacgc
ggaagaatgatgccatttttgcaagggattgatttccagtattgcaaaggatgtctgaaa
tgtgtagatatttgcccgtcgggggcattaagctcgcgtcgcgagcaatggggatgggcg
gaacagaatcgagttgcccaccaatttccggcatatgaaggagggcgttcataa

DBGET integrated database retrieval system