KEGG   Paenibacillus polymyxa E681: PPE_02838Help
Entry
PPE_02838         CDS       T01319                                 

Definition
(GenBank) farnesyl-diphosphate synthase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00900  Terpenoid backbone biosynthesis
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01130  Biosynthesis of antibiotics
Module
ppy_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:ppy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PPE_02838
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ppy01006]
    PPE_02838
Enzymes [BR:ppy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     PPE_02838
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     PPE_02838
    2.5.1.29  geranylgeranyl diphosphate synthase
     PPE_02838
Prenyltransferases [BR:ppy01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   PPE_02838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ADM70665
UniProt: E0RDY4
Position
complement(3096777..3097700)
Genome map
AA seq 307 aa AA seqDB search
MKTAVKGLNRPSFKEYLTGTTDVVSSALIEQFPADWNIPAVLRESMNYSLTAGGKRLRPL
LVIAAAEAFGGSREAALPVACAVEMVHTYSLIHDDLPAMDDDDYRRGKLTNHKVYGEAVA
VLAGDALLTHAFYSIVQAGRRHGVSSDALLSIVEDLSEMSGARGMVGGQVADMSGEQGMT
GIEELEFIHLHKTADLIIFSLLAGGRIGGADKSQLEALRRFGRDLGLAFQIQDDILDLIG
DESKMGKKTQSDVEQEKVTYPYFIGMDASLQQVEELTASAKKVITESGIPDFSRLLEIAD
YLMKRDH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggcggtgaagggcttgaatagaccgtcgttcaaggaatatttgaccgggacg
acggatgtagtttcatccgcactgattgagcagttcccggccgattggaacattcccgct
gttcttcgagaatccatgaattactcactcaccgcaggcggaaaacggctgcggcctctg
cttgtgatcgctgctgctgaagcattcggtggaagcagggaagctgcgctgccagtggca
tgtgcggtagaaatggtacatacgtactccctcattcatgacgacttgccagccatggat
gatgatgattatcggcgaggtaagctgacgaatcataaggtatacggtgaggcggttgct
gtccttgcgggtgatgctttgttgacccatgccttttacagcattgtgcaagcaggacgg
cgtcacggtgtttcatccgatgcgctattgtccattgttgaggatttgtccgaaatgagt
ggcgcgcggggcatggtaggcggacaggtcgccgatatgtcaggagagcaaggaatgacg
gggatcgaggaactggaatttatccatcttcataaaactgctgatttgattattttctcg
ctcttggcaggtggacggattggtggggcggacaagagtcaattagaggcgcttcgccgc
tttggacgagacttggggctggcttttcagatacaggacgatatactggacctcataggc
gatgagagcaaaatgggtaagaaaacgcaaagtgatgttgaacaggagaaggtcacctat
ccttatttcattggtatggacgcatctttgcagcaggtggaggaactcaccgcatctgct
aaaaaagtgataacagagagtggtattcccgatttttctcgtttgttggagatagccgat
tacctgatgaagcgtgatcattag

DBGET integrated database retrieval system