KEGG   Paenibacillus polymyxa E681: PPE_03303Help
Entry
PPE_03303         CDS       T01319                                 

Definition
(GenBank) 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00300  Lysine biosynthesis
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01230  Biosynthesis of amino acids
Module
ppy_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ppy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    PPE_03303
Enzymes [BR:ppy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     PPE_03303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ADM71121
UniProt: E0RJ13
Position
complement(3628356..3629069)
Genome map
AA seq 237 aa AA seqDB search
MSIEMNTQEVINVIKNSKKKTPVKVYVKGALASASFGENVQAFISGDSGVVFGDWADIKP
VLDSANAKEEDYVVENDRRNSAVPMLDLKGINARIEPGAYIRDMVGIGNNAVIMMGAVIN
IGVTIGEGTMIDMNAVLGGRVKVGNMCHIGAGVVLAGVIEPPSAQPVVVEDDVLIGANSV
VLEGVRIGKGAVVAAGAVVTEDVPEYSVVAGTPARVIKQVDDKTKSKTEILKELRVL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgaaatgaatacacaagaagtcatcaacgtgattaaaaacagcaagaaaaag
acgcctgttaaagtatatgtaaaaggagctttggcttccgcatcttttggcgagaatgtt
caagcttttatttctggagacagtggtgttgtatttggtgattgggctgatatcaagcct
gtactggatagcgcaaacgcgaaagaagaagactatgtggtggaaaatgaccgccgtaac
tctgctgttcctatgctcgatttgaaaggcatcaatgcccgcattgagccaggcgcatat
attcgtgatatggttggcattggtaacaacgcagtcatcatgatgggtgcagtgattaac
atcggtgtcaccattggtgaaggcacgatgattgatatgaatgctgtgctgggcggtcgt
gttaaagtaggtaacatgtgtcacatcggtgcaggcgttgtcctggcgggtgtcattgaa
ccaccatctgcacagccagttgtagtagaagacgatgtattgatcggtgcgaactcggtc
gtattggaaggcgtgcgaattggtaaaggcgcagttgttgcagccggagctgtcgtaact
gaagatgtgcctgaatactccgtagtggcgggtacacctgcacgtgtgatcaaacaggtc
gatgataagaccaaatctaaaactgagattttgaaagaactgcgcgttctgtaa

DBGET integrated database retrieval system