KEGG   Paenibacillus polymyxa E681: PPE_03431Help
Entry
PPE_03431         CDS       T01319                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00260  Glycine, serine and threonine metabolism
ppy00750  Vitamin B6 metabolism
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01120  Microbial metabolism in diverse environments
ppy01230  Biosynthesis of amino acids
Module
ppy_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPE_03431
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PPE_03431
Enzymes [BR:ppy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PPE_03431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP AAA_31 PDZ_assoc
Motif
Other DBs
NCBI-ProteinID: ADM71248
UniProt: E0RK10
Position
complement(3740506..3741897)
Genome map
AA seq 463 aa AA seqDB search
MRYISTRGRVEAKGFIDTVLMGLADDGGLMVPEQIPTVSAATLEQWATLSYRELLLEVFA
LYINDEIPREDLEQLVERSYASFRHPEVTPVKKINDSLSILELFHGPTFAFKDVALQFMG
EFYSYVSKKQNEIIHILGATSGDTGAAAIQGVRGKEGIKICILHPHQKVSKVQELQMTTV
DDENVLNLSVKGNFDDCQKVIKDLFADLDFKAKHHLRAINSINFVRILAQTVYYFYAYFR
AQESAGNKKINVSVPSGNFGNIFSGFLAKKMGLPIHKLIIATNENNILERFVKTGEYQPG
DFKSTYSPSMDIQVASNFERYLYYFLGEDAAKVSEYMNNLKTEGRIVISAEDLKRVQQDF
EALGASNEQCLELIKKYKAEYDYLLDPHTACGIAAYEAYNGADEVCVTFATAHPAKFDEA
IRLVDIKQEFPAPIEQLFSKPQHQQVVEHDEAEIVRQLEAFYV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagatatataagcactagaggtcgagtagaagccaagggatttattgataccgtgctc
atggggttagctgacgatggaggtctgatggtaccggagcagattccaaccgtgtcggca
gctacgttagagcaatgggctacattgagctacagagagctgctgctggaagtttttgcg
ctgtatatcaatgatgaaattcctcgtgaagatttggaacaactggtggagcgcagttat
gcgagcttccgtcacccggaagttacgccagtgaagaagatcaacgattccctgtctatt
ttggagctgttccacgggcctacgttcgcgttcaaggatgtggcgctgcaatttatgggt
gagttttattcctatgtgtccaaaaagcagaatgagatcattcacattttgggtgcaacc
tcaggcgatactggggcagcagccattcaaggcgtacgaggcaaggaaggcatcaaaatc
tgtattttgcatccgcatcaaaaagtgagtaaggtacaagaactgcaaatgacgacggta
gacgatgagaacgtgctgaatctatctgtaaaaggaaactttgacgattgtcaaaaagtg
attaaggacctgttcgctgatttggacttcaaagccaaacatcatctgcgggcgattaac
tcgattaactttgtgcgtattttggcgcagacggtatattatttctatgcttatttccgg
gcgcaagagtctgcgggtaacaaaaagatcaatgtcagtgtgccatccggcaactttggc
aatattttttccggctttcttgcgaagaaaatgggcttgccgatccataagctgatcatt
gcaacgaatgaaaataatattttggagcgcttcgtgaagacaggcgaataccagccgggc
gactttaaaagcacatacagtccttcgatggacattcaggtggcgagcaacttcgaaaga
tacctgtattacttcctcggtgaggatgcagccaaggtatctgaatacatgaataacctc
aaaaccgaggggcggattgtgatcagtgcagaggatttaaaacgggtgcaacaggatttt
gaagcgctcggtgcttcgaatgagcagtgtctggagctgatcaaaaaatacaaggctgaa
tacgattatttgctcgatccgcatacggcttgcggtattgccgcgtatgaggcgtataat
ggcgcggacgaagtctgtgtgaccttcgcgacagcacatccggccaaatttgatgaagcc
attcgtctggtggacattaagcaggagtttccggcgccaattgaacaattgttctccaag
ccacaacaccagcaggtggtagagcatgacgaggccgaaattgtgcgtcagcttgaagcc
ttttatgtgtaa

DBGET integrated database retrieval system