KEGG   Pseudomonas poae: H045_00375Help
Entry
H045_00375        CDS       T02456                                 

Definition
(GenBank) gluconolactonase
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
ppz  Pseudomonas poae
Pathway
ppz00053  Ascorbate and aldarate metabolism
ppz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    H045_00375
Enzymes [BR:ppz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     H045_00375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL DUF5122 PD40
Motif
Other DBs
NCBI-ProteinID: AGE24151
Position
complement(86621..87166)
Genome map
AA seq 181 aa AA seqDB search
MGNFVFSTMDAGEAVQTIGRFHRFNAATLKTETLDLPEVAIPNSICFSPDGSTMYYADSL
QGCIFCCDYPSLENQRVFTTVNGQGAPDGSCIDAQGFLWNAEWGGSRVVRYATDGKVDSV
IDSPCIQTTCPVLAGLGYETLYCTSARIGLDKPADFDGTLIKAEAVLAAGSPEERFTGRL
H
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggcaactttgtgtttagcactatggatgccggtgaggcggtgcaaactatagggcga
tttcaccggttcaatgccgcgacgctcaagactgaaacgctggaccttcccgaagtggcg
atcccgaacagcatctgttttagcccggacggttccaccatgtattacgcggactccctg
caaggatgcattttctgctgcgattacccgtcgctagaaaaccagcgtgtattcactaca
gtcaacggtcagggtgctccagacggttcttgtattgatgcgcagggctttctctggaat
gcggaatggggcggtagcagagtcgtgcgttacgcgactgacggcaaagttgacagcgtg
atcgactccccgtgtattcagaccacttgtccggtgttagcgggacttggttatgaaacg
ctttactgcaccagcgcacggatagggctggataagccggcagatttcgatggcacgctg
ataaaagccgaagccgttttagctgccggatcccctgaagagcgatttacaggacgactg
cactga

DBGET integrated database retrieval system