KEGG   Pseudomonas poae: H045_00495Help
Entry
H045_00495        CDS       T02456                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ppz  Pseudomonas poae
Pathway
ppz00900  Terpenoid backbone biosynthesis
ppz01100  Metabolic pathways
ppz01110  Biosynthesis of secondary metabolites
ppz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H045_00495 (ipk)
Enzymes [BR:ppz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     H045_00495 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AGE24175
Position
complement(110621..111469)
Genome map
AA seq 282 aa AA seqDB search
MSERLTLPSPAKLNLMLHILGRREDGYHELQTLFQFLDYGDELTFAVRGDGVIRLHTEFE
GVPHDSNLIVKAARTLQEQSGCALGIDIWIDKILPMGGGIGGGSSNAATTLLGLNHLWQL
DWDQDRLAALGLTLGADVPVFVRGHAAFAEGVGEKLSPEYPDEPWYVVLVPQVSVSTAEI
FSDPLLTRNSPPIKVRPVPKGNSRNDCLPVVARRYPEVRNALNLLGKFTEAKLTGTGSCV
FGGFPSKAEADKVSALLTETLTGFVAKGSNVSMLHRKLQSLL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaacgcctgaccctgccctccccggccaagctcaacctgatgttgcacattctg
ggtcgccgtgaagacggctaccacgagctgcagacgctgtttcaatttctcgactatggc
gacgaactcacctttgccgtgcgcggcgacggcgtgatccggctgcacacggaatttgaa
ggcgtgcctcacgacagcaacctgatcgtgaaggcagcccgcacacttcaggaacaatcc
ggttgcgcgctgggcatcgacatctggattgacaagatcctgcccatgggcggcggtatc
ggtggcggcagttcgaatgcggcgaccaccctgctggggctcaaccacctgtggcaactg
gactgggaccaggatcgcctggccgcgctgggcctgacgctgggcgccgatgtgccggtt
ttcgtgcgtgggcacgcggcttttgccgagggtgtgggcgagaaactcagccccgaatac
cccgacgagccgtggtatgtcgtgcttgttccgcaagtatctgtaagtacagcagaaatt
ttttcagatccgctgttgacacgtaactctcctcccattaaagtgcgccccgttcccaag
ggaaacagtcgaaatgactgcttgccggttgtagcaaggcgttatccagaagtacgtaac
gctttgaatttgttaggtaaatttaccgaagcaaaattaaccggcactggaagttgtgtg
tttgggggcttcccaagcaaagctgaagctgataaagtctcggcccttcttacagagacc
cttacagggtttgtagcaaagggaagcaacgtttcgatgttgcatcgcaagctgcaaagt
ctgctctaa

DBGET integrated database retrieval system