KEGG   Pseudomonas poae: H045_06265Help
Entry
H045_06265        CDS       T02456                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppz  Pseudomonas poae
Pathway
ppz00071  Fatty acid degradation
ppz00072  Synthesis and degradation of ketone bodies
ppz00280  Valine, leucine and isoleucine degradation
ppz00310  Lysine degradation
ppz00362  Benzoate degradation
ppz00380  Tryptophan metabolism
ppz00620  Pyruvate metabolism
ppz00630  Glyoxylate and dicarboxylate metabolism
ppz00640  Propanoate metabolism
ppz00650  Butanoate metabolism
ppz00900  Terpenoid backbone biosynthesis
ppz01100  Metabolic pathways
ppz01110  Biosynthesis of secondary metabolites
ppz01120  Microbial metabolism in diverse environments
ppz01130  Biosynthesis of antibiotics
ppz01200  Carbon metabolism
ppz01212  Fatty acid metabolism
ppz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    H045_06265
   00630 Glyoxylate and dicarboxylate metabolism
    H045_06265
   00640 Propanoate metabolism
    H045_06265
   00650 Butanoate metabolism
    H045_06265
  09103 Lipid metabolism
   00071 Fatty acid degradation
    H045_06265
   00072 Synthesis and degradation of ketone bodies
    H045_06265
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H045_06265
   00310 Lysine degradation
    H045_06265
   00380 Tryptophan metabolism
    H045_06265
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H045_06265
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H045_06265
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H045_06265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppz04147]
    H045_06265
Enzymes [BR:ppz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     H045_06265
Exosome [BR:ppz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H045_06265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGE25327
Position
complement(1358401..1359582)
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLANIPAPELGAAVIRRLLEQTGLDPAQVDEVILGQVLTAG
SGQNPARQASILAGLPHAVPALTLNKVCGSGLKALHLGAQAIRCGDAEVIVAGGMENMSL
APYVLPAARTGLRMGHATMIDSMITDGLWDAFNDYHMGITAENLVDKYGISREAQDAFAA
ASQQKAAAAIETGRFVDEITPILIPQRKGDPVAFTVDEQPRAGTTAESLGKLKPAFKKDG
SVTAGNASSLNDGAAAVLLMSADKAKALGLPVLARIASYANAGVDPAIMGIGPVSATRRC
LDKAGWTLADLDLIEANEAFAAQALAVGKELEWDADKVNVNGGAIAIGHPIGASGCRVLV
TLLHEMIKRDAKKGLATLCIGGGQGVALALERN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtgattgttgctgccacccgcaccgccgtgggcagctttcagggttcg
ctggcgaatattccagcaccggaacttggcgccgccgtgatccgccgcttgctggagcag
accggcctggacccggcccaggtggacgaagtgatcctcggccaggtgctcaccgcaggt
tcgggtcagaacccggcgcgccaggcctcgatccttgccggcttgccccacgccgtgccg
gccctgaccttgaacaaagtctgcggctcgggcctcaaggccctgcacctcggcgcgcag
gcgattcgctgcggcgatgccgaggtgattgtcgccggcggtatggaaaacatgagcctg
gccccctatgttttgccggctgcgcgcaccggtttgcgcatgggtcacgccactatgatc
gacagcatgatcactgacggcctgtgggatgcgttcaacgactaccacatgggcatcacc
gccgagaacctggtggacaagtacggcatcagccgtgaagcccaggatgccttcgccgcc
gcgtcccagcaaaaagccgccgcggctattgaaaccgggcgatttgtcgatgagatcacg
ccgatcctaataccccagcgcaagggcgaccccgtggccttcaccgtggatgagcaaccg
cgcgccggcaccaccgctgagtccctgggcaagctcaaacccgcgttcaagaaagacggc
agcgtcaccgccggcaacgcttccagcctcaatgacggcgctgccgcggtgttgctgatg
agtgcggacaaggccaaggcgctcgggctgccagtactggcgcgtatcgccagctacgcc
aacgccggtgtcgacccggccatcatgggcatcggcccggtgtcggcgacccgccgctgc
ctggacaaggccggttggacacttgccgatttggacctgatcgaagccaacgaagccttc
gccgcgcaggcgttggcggtgggcaaggagctggagtgggacgccgacaaggtcaacgtc
aacggaggcgccatcgccatcggccacccgatcggcgcctcaggctgccgcgtgctggtg
accctgctgcatgaaatgatcaagcgcgatgccaaaaaaggcctggccaccctgtgcatc
ggcggcggtcaaggcgtagccctggccctcgaacgcaactga

DBGET integrated database retrieval system