KEGG   Pseudomonas poae: H045_06810
Entry
H045_06810        CDS       T02456                                 

Definition
(GenBank) sigma-54 dependent transcriptional regulator, Fis family protein
  KO
K11914  sigma-54 dependent transcriptional regulator
Organism
ppz  Pseudomonas poae
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ppz03000]
    H045_06810
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppz02044]
    H045_06810
Transcription factors [BR:ppz03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    H045_06810
Secretion system [BR:ppz02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   H045_06810
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_8 AAA_5 HTH_30 HTH_50 HTH_28 AAA AAA_7
Other DBs
NCBI-ProteinID: AGE25434
Position
1479598..1481118
AA seq 506 aa
MTDEMFTRLPQPLVYAETLMGWFCRLGRGADEKTLANLCVAGVAQLSQCELCQLYRLDQA
TGRLALIAQHLHGGWMTSDPALGHGAQDEQLLQYVLAQGQTITLDDLSRCVYDCGFLPEA
TTSWRSLCGIPLRGPGDTVSGVLLCASQRPVALQGYVASLAQLGSFALGQLAKASRIAPE
VSVLKSGASLAGAFGLIGISTAMEATCRLISKVLRTPYTVLLRGETGTGKEVAARAIHAA
GQRSHKAFVVQNCAAFPEGLLESELFGYRKGAFTGALRDYAGLFDAADGGTLLLDEIGDM
PLSLQAKLLRVLQEGEIRPLGAVASHKVDVRIIAATHRDLAAMVAEGSFREDLYYRLAQF
PIELPALRDRDGDMLLLARHFAEKACVALGREAVGWSSDALDQLTNHDFPGNVRELKCLV
ERAVLMCDEDVILPVHLALAPSPVTVVDTTLRKRLERVERTVLIDCLHRNRGNRTRTARE
LGVARRTLLYRLARLNIPCGEAKGEC
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgaccgatgagatgtttactcgattgccacagcccctggtctacgccgaaaccttgatg
ggctggttctgccggctcggccgtggggctgatgaaaagaccttggcaaacctttgcgtg
gctggcgttgcacaactgagccagtgcgaactctgccagttgtaccggcttgatcaggct
accggcaggctcgcgctgattgcccagcatttgcacggaggctggatgacgagcgacccg
gctttgggccacggagcgcaggatgagcaactgttgcaatacgtcctggcccaggggcaa
accatcactttggatgacctgagccggtgtgtgtacgactgcggttttttacccgaggcg
accacatcctggcgctccctttgcggtatcccattgcgtggccccggcgacaccgtcagc
ggcgtcctgctgtgtgccagtcagcgtccggtcgcgttgcagggctatgtagcgtcattg
gcgcaattgggcagttttgccttggggcaactggccaaggcatcgcgcatcgcgcctgag
gtgagcgtgctgaagtctggcgcttcgctggcgggagcgttcggcctgattggcatcagc
acggcgatggaggcgacttgtcgcctgatcagcaaggttttgcgcacgccctatacggtg
ctgttgcgtggcgaaaccggcaccggcaaggaagtcgcggcgcgcgccatccacgccgca
ggccaaagaagtcacaaagcctttgtggtgcagaactgtgcggcgtttccagaggggctg
ctggagagcgaactgttcggttatcgcaaaggtgcgttcaccggtgcgctgcgtgactac
gcggggttattcgacgccgccgatggcggcacgttgctgttggatgaaatcggcgatatg
ccgctgtcgttgcaggccaagttgctgcgtgtgttgcaggagggcgagattcgaccgctg
ggggccgttgcctcgcacaaggtcgacgtgcgaatcattgccgctacgcaccgcgatctg
gcggcaatggtcgccgaaggcagtttccgtgaggatctgtattaccggttggcacaattt
ccgatcgagctgccggcgctgcgtgaccgagacggcgacatgctgttgctcgcccgacat
ttcgcggaaaaggcctgcgtggcacttggaagggaggccgtcggctggtccagtgacgcc
ctggaccaactgacgaatcatgacttccccggcaatgtgcgcgaactcaaatgcttggtg
gagcgtgccgtgctgatgtgtgacgaagacgtgatcctgccggttcacctcgcgttggcc
cccagcccggtcactgtcgtggacaccacgttgcgcaagcgtctggagcgtgttgagcgc
acggtgctgatcgattgcctgcacaggaatcgcggcaaccgcacccgcaccgcgcgtgag
ttgggggtggcgcggcgcacgctgctctaccgcctcgctcgtttgaatattccttgcggc
gaggccaagggtgaatgctga

DBGET integrated database retrieval system