KEGG   Pseudomonas poae: H045_06820
Entry
H045_06820        CDS       T02456                                 

Definition
(GenBank) type VI secretion protein Fha2
  KO
K11894  type VI secretion system protein ImpI
Organism
ppz  Pseudomonas poae
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppz02044]
    H045_06820
Secretion system [BR:ppz02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   H045_06820
SSDB
Motif
Pfam: FHA Yop-YscD_cpl TAD2
Other DBs
NCBI-ProteinID: AGE25436
Position
1481333..1482505
AA seq 390 aa
MQLMFEVYESAGADPASMAPKLFTEAGGVIGRGAGCDWVIADSSRLLSSHHGLVSFREGQ
YFLTDISSNGICVAGSGERLCKGQARLVEDGDVFQLGALFIRARLVASPAPQGELQRAAG
GQIPDDAFLGLDPSRAMDQASLPPDDILATSDEPAQRVYQQAPDRDYMSLPRRVEPVPDG
PPLEDLERTPALHASFWAQFSAALGLDLNGVDTPRREALAIKVASLLKQGIEGLQQSLRT
CDELKNESNLAPSEARLRSANPLRHCSDGKAALAALLGMNEWGQLPAEAALVQAHRDLQS
HQVALLTACRTALRNGYRVFAPSHLMLCFERQEKAPWFNADGAHWRAYQRHYQRLIEEEP
LSERLLGNDFANAYEEQVRLISTLHAACPG
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgcaactgatgtttgaagtgtatgaaagcgcaggcgcagatcccgcgtctatggcccct
aaactgttcaccgaggccggtggcgtgattgggcgtggcgccggttgcgattgggtcatt
gccgactccagtcggctgctgtccagtcaccatgggttggtgagttttcgcgaaggtcag
tattttctgaccgacatcagcagcaatggaatctgtgtggcgggcagcggtgagcggctg
tgcaaagggcaggcacgcctggtcgaagatggcgatgtattccagctgggcgcactgttc
attcgggcgcggctggtcgcatcaccggccccgcagggcgaactgcagcgcgcggcgggt
gggcagattcccgacgatgctttcctggggctggatccgagccgggcaatggatcaggcc
tcgctgccaccggacgacatcctcgctaccagcgacgaacccgcgcaacgggtttatcag
caagcgccagacagggactatatgagcctgccacgccgggtcgagcctgttcctgatgga
ccaccgcttgaagatctcgaaaggacaccggctttgcacgcgtcgttctgggcgcagttt
tcggcggcactcggacttgacctcaacggtgtcgacaccccacggcgcgaggcgttggca
atcaaagtcgccagtttgctcaagcagggtatcgagggcttgcagcaaagcctgcgcacc
tgcgacgagctgaaaaacgaatcgaaccttgcgccttccgaagcccgcctgcgcagtgcc
aaccccctgcgccattgctccgacggtaaagcggcattggcggcgttgctgggtatgaac
gagtgggggcaattgccggccgaggccgccctggtccaggcccaccgggatctgcaatcc
catcaggtagccctgctgacagcgtgtcgcaccgcactgcgcaatgggtaccgggtattc
gcgcccagccacttgatgttgtgcttcgagcgccaggaaaaagctccctggttcaatgcc
gacggggcgcactggcgcgcctaccaacgccattatcaacgcctgatcgaggaagaaccg
ttgagcgagcgcctgttgggcaatgactttgccaatgcctacgaagagcaggttcgcctg
atttccacccttcatgcggcttgcccgggatga

DBGET integrated database retrieval system