KEGG   Pseudomonas poae: H045_06850
Entry
H045_06850        CDS       T02456                                 

Definition
(GenBank) serine-threonine kinase Stk1
  KO
K11916  serine/threonine-protein kinase Stk1 [EC:2.7.11.-]
Organism
ppz  Pseudomonas poae
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppz02044]
    H045_06850
Enzymes [BR:ppz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     H045_06850
Secretion system [BR:ppz02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   H045_06850
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH DUF3751
Other DBs
NCBI-ProteinID: AGE25442
Position
1489288..1490124
AA seq 278 aa
MTAPLCPGDLLAGRYQLERVLGIGGMGVVYRARDLLHEQFGEPRSSVALKVLGECFSECP
DAHVLLYSEFSLTRSLLHPGVVRMFGFDVDTRRQLAFFTMELMHGMTLDRLLLERPAGFG
WHEWQPMALQLLDALAYAHGQGVLHGDVKPGNVMVGEAGIRLFDFGLGQSQAMTGLPGMD
RHRISAWTPAYVAPELLEGAELSASADVYGAACVLYQMAQGRRPGERNPTHVLNRPRQLP
RHCWPALRTALAMDPAQRTITVAEVREALAGRSWRWLA
NT seq 837 nt   +upstreamnt  +downstreamnt
atgacagcgcctctgtgccccggcgacctgctcgcgggtcgctatcagctcgagcgcgtg
ctgggcatcggaggtatgggcgtggtctaccgcgcccgcgacctgttgcatgagcagttc
ggtgaacctcggtccagcgttgcgttgaaagtactcggcgagtgtttttccgaatgcccg
gatgcccatgtgctgctgtacagcgagttctccctgacacgcagccttttgcacccgggg
gtggtgcgcatgttcggcttcgatgtcgacacccgccggcagttggcgtttttcaccatg
gaattgatgcacggcatgaccctggatcgactcctgctggagcgtcccgccggcttcggc
tggcacgagtggcagccaatggccctgcaactgctggacgcattggcttatgcccatggg
cagggcgtgctgcatggtgacgtgaagccgggcaatgtcatggtgggggaggcggggata
cgtctgttcgatttcggcctgggccagtcgcaggcaatgacagggctgcccggtatggac
cgtcatcgcatcagcgcctggacgcctgcttatgtcgcgccagagctgttggagggggca
gagctgtcagcgtcggcagatgtttatggcgcagcatgcgtgttgtatcagatggcacaa
gggcggcgtccgggcgagcgcaatcccactcatgtgctcaaccgaccccgccagctgccg
cgccattgctggccagccttgcgcacggcgctggcgatggacccggcgcagcgaacgatc
acggtcgccgaagtgcgcgaggcgctggctggccgctcatggcgctggcttgcctag

DBGET integrated database retrieval system