KEGG   Pseudomonas poae: H045_13220Help
Entry
H045_13220        CDS       T02456                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
ppz  Pseudomonas poae
Pathway
ppz00360  Phenylalanine metabolism
ppz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppz00790  Folate biosynthesis
ppz01100  Metabolic pathways
ppz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    H045_13220 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    H045_13220 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H045_13220 (phhA)
Enzymes [BR:ppz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     H045_13220 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AGE26709
Position
3059635..3060426
Genome map
AA seq 263 aa AA seqDB search
MKQTQYVAREPDAQGFIHYSPEEHAVWNTLITRQLTVIEGRACQEYLDGIDKLALPLDRI
PQLGEINQVLADTTGWQVARVPALIPFQTFFELLASKQFPVATFIRTREELDYLQEPDIF
HEIFGHCPLLTNPWFAEFTHTYGKLGLAATKEQRVYLARLYWMTIEFGLVDTPAGLRIYG
GGILSSPRETVYSLSAQPEHQAFDPLEAMRTPYRIDILQPLYFVLPELKRLFDVAQEDIM
GMVERGMQLGLHAPKFPPKPKAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagacgcaatacgtggcccgcgagcccgatgcgcaaggttttatccattactcg
ccggaagaacacgcggtatggaacaccctgatcacgcgccaactgactgtgatcgagggt
cgcgcctgccaggaatacctggacggtatcgacaagcttgccctgccactggaccgcatc
ccgcaactgggcgaaatcaatcaagtgctggccgacaccaccgggtggcaagtggcccgc
gtgccggcgctgatccccttccagactttcttcgaactgctcgccagcaagcagtttccg
gtggccaccttcatccgcacccgcgaggaactcgactatctgcaagagccggatattttc
cacgagatcttcggccactgcccgctgctgaccaacccctggttcgctgaattcacccac
acctacggcaagctcggcctggcggccaccaaggagcaacgggtgtacctggcgcgtttg
tactggatgaccatcgaatttggcctggtcgatacccccgccggcctgcgcatctacggt
ggcggtattctgtcgtcacccagagagacggtgtacagcctgtctgcgcagcccgaacat
caagccttcgacccgctggaagcaatgcgcacgccgtatcgcatcgacatcctgcaaccg
ctgtattttgtcttgcccgagctcaagcgcctgttcgacgtcgcacaggaagacatcatg
ggcatggtcgagcgcggcatgcagttggggctgcacgcgcccaagttcccacccaagccc
aaggctgcgtga

DBGET integrated database retrieval system