KEGG   Pseudomonas poae: H045_20360
Entry
H045_20360        CDS       T02456                                 

Definition
(GenBank) putative phosphatase
  KO
K11915  serine/threonine protein phosphatase Stp1 [EC:3.1.3.16]
Organism
ppz  Pseudomonas poae
Pathway
ppz02025  Biofilm formation - Pseudomonas aeruginosa
ppz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    H045_20360
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    H045_20360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppz02044]
    H045_20360
Enzymes [BR:ppz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     H045_20360
Secretion system [BR:ppz02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   H045_20360
SSDB
Motif
Pfam: PP2C_2 PP2C SpoIIE
Other DBs
NCBI-ProteinID: AGE28134
Position
complement(4620784..4621503)
AA seq 239 aa
MGATYKSASKSHVGMVRQVNEDACLDLPENRLWVVADGMGGHAAGDYVSSLIVDSLRSVA
MGRSLDEYTAALRNDLVRINTAVREETANRGVSLMGSTVVVLAARGLRGVCLWAGDSRLY
RLRDGVLDSISRDHSYVQDLQDSGLLSEADARTHPRANIVTRAVGVEAQLNLAAVELLIA
PGDSYLLCSDGLTKTVEDHEIRDVLGHNAPDEIVRSLVHLGLNRGAPDNITAIVVKVSA
NT seq 720 nt   +upstreamnt  +downstreamnt
atgggggcgacgtacaaatccgcgagcaaaagccatgtgggcatggtgcgccaggtcaat
gaagacgcgtgcctggacctgccggaaaaccgcctgtgggtggtggccgacggcatgggc
gggcatgcggccggcgactatgtcagcagcctgatcgtcgacagcctgcgcagtgtggcg
atgggccgttccctcgacgaatacacggctgcgctgcgcaacgacctggtccgtatcaac
acggccgtgcgtgaagaaaccgccaaccgtggcgtcagcctgatgggcagcaccgtggtg
gtgctcgccgcccgtggcctgcgcggcgtgtgcctgtgggctggcgacagtcgcctgtat
cgcctgcgcgacggcgtgctcgacagtatctcccgtgaccacagctacgtgcaggacctg
caggacagcggcctgctcagcgaagccgatgcccgcacacatccgcgcgccaatatcgtc
acccgcgccgtgggcgtggaggcccagttgaacctggcggcggtcgagcttttgatcgcc
cccggcgacagctacctgttgtgcagcgacggcctgaccaagaccgtcgaagaccatgaa
atccgcgacgtgctcggtcacaacgcacccgatgaaatcgtgcgcagcctggtgcacctg
gggctcaaccggggcgcgccggacaacatcaccgccattgtcgtgaaggtgtcggcatga

DBGET integrated database retrieval system