KEGG   Pseudomonas poae: H045_20365
Entry
H045_20365        CDS       T02456                                 

Definition
(GenBank) type VI secretion-associated protein TagF
  KO
K11890  type VI secretion system protein ImpM
Organism
ppz  Pseudomonas poae
Pathway
ppz02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    H045_20365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppz02044]
    H045_20365
Secretion system [BR:ppz02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   H045_20365
SSDB
Motif
Pfam: TagF_N
Other DBs
NCBI-ProteinID: AGE28135
Position
complement(4621504..4622157)
AA seq 217 aa
MTTLGFYGKLASRGDFVSRTLPQSFVGPWDSWLAAGLLASQNSLGGDWLNVYLVSPLWRF
VLSPGVCGPDAAAGVVMPSIDRVGRYFPLAVVALLDHDTNPASLVGGPDAWFEQAEELLL
STLDAGATFEGFNAGLDRLGVPATEPRAVDSRFAGLQRMAATLPHGRLAALAEQACEGAS
LWWGRGSQRIAPGLLRCQGLPATGDFAQFLLGQEGVV
NT seq 654 nt   +upstreamnt  +downstreamnt
atgacgaccctgggtttctacggcaagttggccagccgtggcgattttgtcagccgtacc
ttgcctcagagttttgtcggcccgtgggacagctggctggcggcgggcctgctcgccagc
cagaacagcctgggcggcgactggctcaatgtgtatctggtcagcccgttgtggcgcttt
gtgctgtcgccgggcgtatgcgggccggatgcagcggcgggtgtggtgatgcccagcatt
gatcgggtggggcgctatttcccgctggcggtggtggccttgctcgatcacgacaccaac
ccggcctcgctggtgggcgggccggatgcctggttcgaacaggccgaagagctgttgctg
agcaccctggatgcgggtgccacgttcgaaggtttcaacgcagggctcgaccggcttggc
gtaccggcgaccgaaccgcgtgcggtcgacagccgtttcgccggcctgcaacggatggcc
gccaccttgcctcacgggcgactggccgcgctggccgaacaggcctgcgagggtgccagc
ctctggtggggccgtggttcgcagcggatcgctcccgggttattacggtgccagggcctg
cctgccaccggcgattttgcgcaatttttgctcggacaagaaggtgtggtgtag

DBGET integrated database retrieval system