KEGG   Pseudomonas poae: H045_20390
Entry
H045_20390        CDS       T02456                                 

Definition
(GenBank) type VI secretion protein Fha1
  KO
K11913  type VI secretion system protein
Organism
ppz  Pseudomonas poae
Pathway
ppz02025  Biofilm formation - Pseudomonas aeruginosa
ppz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    H045_20390
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    H045_20390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppz02044]
    H045_20390
Secretion system [BR:ppz02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   H045_20390
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: AGE28140
Position
complement(4628864..4630087)
AA seq 407 aa
MAIGRSSENDWVLPDPERLVSSQHCVIQYKDGRYYLTDNSTNGVELVNAGIRMRRGNSEP
LQDGELIRIGDYEIQARIDFTVQTIDSQAFAGDSPNSFEALMGAVANTPQATPAIAPQFQ
GASSMDTLPDLFDFLGPAAVPPPTVADHVPSEQHDFRPPAPVAAPIVETPGASAAVIPED
WDLLGDAPPPPAPVIAAPPVVEPALPVVSAQPQPDLLQAFLRGAGLDQLRLDNADACAQM
ESIGRSYRLMVEGLIDVLRARASLKGEFRMQQTMIQPAENNPLKFAPNADEALLLLLRHG
NQAFMAPDVAVRESFDDLRAHQLAVMAGVEAAIKHLLARFEPAQLEARMGKPGGLSSLFH
GSRQAQYWQQFTELYSNISREAQEDFQDLFGREFSRAYEEHSARQRR
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggcgatcggccgcagttcggaaaacgactgggtattgcccgatccagagcgtctggtc
tcttcacaacattgcgttattcaatacaaggatggccgttattatttaacggataacagc
accaatggcgtggaattggttaacgccggtattcgcatgcgccggggtaacagcgagccg
ttacaggacggcgagttgatccgcatcggtgattacgaaattcaggcgcgcatcgatttc
actgtgcaaaccattgatagccaagcctttgccggtgactcgccgaacagcttcgaagcg
ttgatgggcgccgttgcgaacacgccccaggccacgccggcgattgcaccgcagttccag
ggtgcctcgtcgatggacaccctgccggacctgttcgactttcttggccccgccgccgtg
ccgccgccgaccgtggcagatcatgtgccgtccgaacagcacgatttccgcccacccgcg
cccgtcgccgcgccgattgtcgaaacgccaggagcgtcagctgcggtgattcccgaagac
tgggacctgctcggcgatgcgccaccgccgcccgcacccgtcatcgctgcgccacctgtg
gtcgagcccgcgctccccgtggtcagcgcccagccgcaaccggaccttttgcaagccttc
ctgcgcggcgccggcctcgatcagctgcgcctggacaacgccgatgcctgcgcccagatg
gaaagcatcggccgcagctaccggctgatggtcgaaggcctgatcgatgtgttgcgtgcc
cgcgccagcctcaaaggcgagttccgcatgcaacagaccatgatccagcccgccgaaaac
aatccgttgaaattcgccccgaatgccgacgaagcgttactgctgttgctgcgtcatggc
aaccaagcgttcatggcaccggatgtggccgtgcgcgagagtttcgatgacctgcgcgcg
caccagctggcggtgatggccggcgtggaagcggcgatcaagcacctgctggcgcgcttt
gagccggcgcagctggaagcacgcatgggcaagcctggcgggctgtcgagtcttttccac
ggctcgcgtcaggcccagtactggcaacagttcaccgagctttacagcaacatttcccgc
gaggcccaggaagatttccaggacctgttcggccgcgagtttagccgagcctacgaagag
cacagtgcacgacagcgtcgctga

DBGET integrated database retrieval system