KEGG   Pseudomonas poae: H045_20455
Entry
H045_20455        CDS       T02456                                 

Definition
(GenBank) hypothetical protein
Organism
ppz  Pseudomonas poae
SSDB
Motif
Pfam: RHS_repeat RHS RES PAAR_motif
Other DBs
NCBI-ProteinID: AGE28153
Position
4643901..4648271
AA seq 1456 aa
MADILGGVLEVAANVAITALATAAVVAATGITVATGGLGACVLGAVVGVIVGIAMSKTGA
DKGLSVLCEGIGNALFPPAVMATIISGSTDTLINSIPAARAAGAVPSHVAPAGTENQAPA
PASDDAEEPGYLDMAKGFFSQMWRPTVATPAPGAVPKPLDLVTCTKHPPMPPQFLAEGSE
KVTVNGQPAVRSGDRSTCDATVVSAGLISPNVTIGGGSVVVREIRSGKTPGVGLAVTALM
MLKGGKGKFLSNLPCMLLGGVNSFVVSQAMGALANAAMGSSNPVHASTGAKVLGGPEELD
FALPGIMPIDWQRFYNSRDERRDGLFGAGWSVSYEVSVQLRPHPEGGEQLLYTDEQGRRI
NMGFIPLGGAVFSAGEGLSVRRHLSGQLLIESADALYRLFEPAPQNTSLLRLSQLGDRND
NRIYLDYDDNGRLRQLRDTFDLVKVELNYDATWPSRVSHIERLYPDQQREVLMHYAYDSC
GDLAAVRQSDGQVKRRFAYDAGRRMTEHQLPGGLRCFYQWACVDEREWRVVRHWTDSGDT
YRFDYELDNGITRIIDGLQRVSTRHWDARHQILESIDALGRTWAFQWNAESQLLGATDPS
GGQYQFSYDEAGNLSETTDPLGRSESTLWLEHWALPLVETDAAGNAWQFRYDSRGNCIGE
TDPLGHVTTYRHDAHGQVLEITDARGASKTLRWTPLGQLSEHTDCSGLTTRLNYCKRGLL
LNSTDALGERTNFAYDDQGRLTSKQLPDGRSEHYQRDASGQLVSYSDPAGHTTHFKHCPS
GRLRQRTDSHGRCVELSHDAYGRLLNLTNENGERYRFDWDAGDRLTLEQRLNGTLKRYAY
DPLDNVTRVETVASSGAEDSITHDLERDAAGRLIAKITADGRTEYSYDEQDQVTAISFTG
HYGEQQRLAFGYDALGQLILEQSTGGRLEHHYDELGNLIQTQLPDGRWLNRLRYGSGHLH
QINLDGQVISDFERDRLHREVLRTQGRISTRSEYDRCGRIRVRQRRQQGQSVLLPALQTR
YGYDASDQLVERVDSQPGATYRQLLHYDATGRILASQDNLQGQREAFAYDPAANLLDGAG
RVAHNQLLSYRDKHYRYDGFGRVVEKRSARRGTQHLSYDAEQRLAQVHNDDGSVVKMTYD
PLGRRIAKTTFDRQGKQQSQTRFTWDAMQLLQEHHGPQTSLYLYVDEGYEPLARIDGVGD
QQKVRYYHNDLNGLPEQLSESDGHRVWKARYEVWGNTVEEVREPYFVEEQNLRFQGQYLD
RETGLHYNTLRFYDPDIGRFTTPYPIGLAGGLNFYQYAPNPVSWIDPLGLMKCSSPPKGR
KVNRTVYRFEEPGRIGTTWQAHKWNVESRHRYTAKGLGGVYGANSRKTALGEVTHWGVDL
SSRVLVSKRVQLNNVLDLTRADVRKQLGVSLKSITGDKYTETHQIGSWAKANGYDGILAP
SARNPTGSNLISFAGF
NT seq 4371 nt   +upstreamnt  +downstreamnt
atggccgatatccttggcggtgtgctcgaagtcgccgctaacgtggcgatcactgcattg
gccacggccgccgtagtagcggccaccgggatcaccgtcgcgacaggtgggcttggcgcg
tgcgtattgggcgccgtcgtcggcgttattgtcggcatcgccatgagcaagaccggtgct
gacaaagggctgagcgtcctgtgtgagggtatcggcaacgcgctgttccctcccgcagtc
atggcaacgatcatcagcgggtcgacagataccctgatcaactcaatacctgcggcgcga
gccgccggggcggtcccctcccacgttgccccggcgggcaccgaaaaccaagcgcctgcc
cccgcgtctgacgatgcagaagaaccaggctacctggatatggccaaaggttttttctcc
cagatgtggcgccccactgtcgccacccccgcaccaggtgccgttcccaaacctctggat
ctggtgacctgcaccaaacatccaccgatgccaccacagtttcttgcagaaggatcggaa
aaggtcacggtcaacggccagccggctgtgcgcagcggcgatcgcagcacgtgtgatgcg
acggttgtgtcagcgggacttatttcgccaaacgtgaccatcggcggtggttcagtggtg
gtacgcgagattcgtagcggcaagacgccgggagtgggcctggctgtgaccgcactaatg
atgctcaagggtggcaagggcaaatttctaagtaatctgccctgcatgctgctggggggc
gtcaactcattcgtcgtcagtcaagccatgggcgccttggccaatgcggccatgggctca
tccaaccccgtgcatgccagcactggggccaaggtgctgggcggcccggaagagctggac
tttgccctgcccggcatcatgccgatcgattggcagcgtttctacaacagccgggacgaa
cgccgcgatggtctgttcggggctggctggagcgtttcctacgaggtcagcgtccagctt
cgcccccaccctgagggtggtgagcaactgctatacaccgacgagcaggggcgacgcata
aacatggggttcattcccttgggcggcgcggtgttcagtgctggcgaggggctgagcgtg
cgacgccacctgagtggccaactgctgatcgaaagtgctgatgccttgtatcgactgttt
gaaccagcgccgcagaatacttcgctgctacgcctgagccagttgggcgatcgcaatgac
aaccgtatttacctggactatgacgacaacggacggctgcgacagctgcgggacaccttc
gatctggttaaggtcgaactgaattacgacgccacctggccaagccgtgtcagtcatatc
gagcgactgtaccctgatcagcagcgtgaagtgttgatgcattacgcctacgacagctgc
ggcgacctggcagccgtgcgacagtccgacgggcaggtgaaacgccggtttgcctatgac
gccggccggcgcatgaccgagcatcaattacctggcgggctgcgctgtttctaccagtgg
gcgtgtgtggatgaacgcgaatggcgcgtggttcggcactggacggatagcggcgacacc
taccgattcgactatgagctggacaacggtatcacccggatcattgacgggttgcagcgc
gtcagcacccgccactgggatgcacggcaccagatcctcgagtccatcgatgctctggga
cgtacctgggcgttccaatggaatgctgaaagccaactgctgggcgcgaccgacccaagc
ggtgggcaataccaattcagctacgatgaagccggtaatctgagcgagaccacagatccg
ctggggcgcagtgaatcaaccctttggctggaacattgggcgctgccgttggtggagacc
gacgccgccggcaacgcctggcagttccggtatgactcacgtggcaattgcatcggcgaa
accgatccgctgggccacgtgacgacttatcgtcacgacgctcacggacaagtcctggaa
attaccgacgcccgcggtgcaagcaagaccttgcgctggacgcccctgggtcaactcagc
gagcacaccgactgttcgggtctgaccacccgcttgaattactgcaagcgtgggctactg
cttaacagtaccgacgccctgggcgagcgcacaaacttcgcttatgacgatcagggacgg
ctgaccagcaaacagttgccggatggccgcagtgagcactatcagcgtgatgccagtggg
caattggtcagctacagcgaccctgcgggtcacaccacgcacttcaaacactgcccaagc
ggacggttgcgccagcgtacggactctcacggccgctgtgtggagctgagtcatgatgcc
tacggtcgcctgctgaacctgaccaacgagaacggcgagcgctatcgcttcgactgggac
gccggtgatcgactgaccctggagcagcgcctgaacggcacgctcaagcgctatgcctac
gatccgctggataatgtcactcgcgtggagacagttgcttcatctggcgccgaagactcc
atcactcacgacctggagcgagacgctgccgggcgactgatcgcaaaaatcaccgcagat
gggcgtaccgaatatagctatgacgaacaggatcaggtcacagccatctccttcaccgga
cattacggcgagcaacaacgcctggcgttcgggtatgacgcactcggccagctgattctt
gaacaaagtaccggcggtcgcctggaacaccactacgacgaactgggtaacctgatacag
acgcagcttcccgatggacgctggctcaaccgattgcgctacggaagtggccacctgcat
cagataaatctggatggtcaggtgatcagtgatttcgagcgcgaccggctgcaccgcgaa
gtgctgcgtacccagggacgtatcagcacccgcagcgaatacgatcgttgcgggcggatt
cgtgttcgccagcgtcggcaacaggggcagtcagtactgctgccagcgctacaaacccga
tacggttatgacgccagcgatcaattggtggaacgcgtcgacagccagcctggcgcaacc
taccgccagctcctgcattacgacgctaccggacgcattctcgccagccaggacaatctt
caggggcaaagggaagccttcgcctatgatccagccgccaatttattggacggcgcaggg
cgcgtggcccacaaccagttactgagctatcgcgacaagcactaccgttacgacggtttt
ggcagggtagttgaaaaacgcagcgctcggcgcggcacccagcacttgagctatgacgct
gagcaacgcctggcccaggtgcacaatgacgacggttctgtggtcaagatgacttacgac
ccgctcggtcgacgcatcgccaagaccaccttcgaccgccagggcaagcagcagagccag
acccgtttcacgtgggatgcgatgcaactgctgcaggagcaccacggcccgcagaccagc
ctctatctctatgtcgatgagggttatgagcccctggccaggattgatggtgtgggtgac
cagcaaaaggtgcgctactaccacaacgacctcaacggcctgcccgagcaactctcggaa
agcgacggccatagggtgtggaaggcgcgttacgaagtctggggcaataccgtcgaggaa
gtgcgcgaaccctatttcgtcgaagagcagaacctacggttccagggccagtacctggac
cgggagactgggctgcactacaacactctgcgcttttatgacccagacatcgggcgcttc
actacgccctatccaatcggtctggcgggcgggcttaatttctaccaatacgcgcccaac
ccggtgagctggatcgaccccttgggactgatgaaatgctcaagcccacccaaaggccgc
aaggtcaatcgcacggtgtatcgattcgaggagcctggacgcatcggtacgacttggcag
gcgcataagtggaatgtggagtcccgacaccggtacacggccaagggactgggtggcgta
tatggcgccaactcgcgcaagaccgcattgggcgaagtcacccattggggtgtggacctg
tcctcacgggtactggtcagcaaaagggtgcagttaaacaacgtgctggacctgacgcgc
gccgacgtgcgcaaacaattaggtgtatcactcaaaagcattacgggtgacaaatacacc
gaaactcaccagatcggcagttgggcgaaagccaatggctatgatgggattcttgcccca
tccgcgcgaaacccgacaggcagcaacttaatatcatttgcagggttctga

DBGET integrated database retrieval system