KEGG   Pseudomonas poae: H045_23120Help
Entry
H045_23120        CDS       T02456                                 

Definition
(GenBank) acyl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
ppz  Pseudomonas poae
Pathway
ppz00071  Fatty acid degradation
ppz00280  Valine, leucine and isoleucine degradation
ppz00410  beta-Alanine metabolism
ppz00640  Propanoate metabolism
ppz00650  Butanoate metabolism
ppz01100  Metabolic pathways
ppz01110  Biosynthesis of secondary metabolites
ppz01120  Microbial metabolism in diverse environments
ppz01130  Biosynthesis of antibiotics
ppz01200  Carbon metabolism
ppz01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    H045_23120
   00650 Butanoate metabolism
    H045_23120
  09103 Lipid metabolism
   00071 Fatty acid degradation
    H045_23120
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H045_23120
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    H045_23120
Enzymes [BR:ppz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     H045_23120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_C Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N AcylCoA_DH_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: AGE28682
Position
complement(5271041..5272843)
Genome map
AA seq 600 aa AA seqDB search
MSETLLSSRNLAFELYEVLDAEGLTQRERFAEHNRETFDAAISTARSIAEKYFAPHNRKN
DENEPRYEDGKAILIPEVKPAVDAFLEAGFLNAARSFEAGGMQLPTLLSQACFAHFQSAN
AASTSYPFLTMGAANLIESFGTEEQKQRFLQPMIDGRFFGTMALTEPHAGSSLSDIRTRA
EPAADGSYRLKGNKIFISGGDHPLSENIVHMVLAKLPDAPAGVKGISLFIVPKFLVNDDG
SLGERNDVLLAGLFHKMGWRGTTSTALNFGDNGNCVGYLVGKPHQGLSCMFQMMNEARIG
VGMGAVMLGYAGYLYSLEYARERPQGRLPDSKDPATAPVAIIQHADIKRMLLTQKAYVEG
AFDLGLYAARLFDDTTTLHTEAERKSAHELLDLLTPIVKSWPSEFCLKANELAIQILGGH
GYTREYPVEQYYRDNRLNPIHEGTHGIQSLDLLGRKLAQNGGAGLKQLIRLIAETGARAQ
QYASLTALREPLEQLVNRLQTVTIGLLTDLAQGKVNNSLANSALYLKVFGHTVIGWRWLE
QAIRAEEGLAKGNAADAAFYKGKLQAARYFLTWEVPGCHHELDILEARDDTCLGMQDEWF
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagacgctgctcagttcccgcaatctggcttttgagctgtatgaagtcctcgat
gccgagggcctgacccagcgcgagcggtttgccgagcacaaccgcgaaaccttcgatgcg
gccatcagcaccgcgcgctccattgccgaaaaatatttcgcgccacataaccgcaaaaac
gacgaaaacgaaccgcgctacgaagacggcaaggccatcctgattccggaagtcaaaccg
gccgtggacgcgtttctcgaagcgggctttctcaatgccgcacgcagtttcgaagcgggc
ggcatgcaactgcccaccctgctgtcgcaagcctgtttcgcgcacttccagtcggctaac
gcggcgtccacgtcttacccgttcctgaccatgggcgccgccaacctgatcgagagtttc
ggcaccgaggagcagaaacagcgcttcctgcaaccgatgatcgacgggcgcttcttcggc
accatggccctcactgaaccccatgccggttcgtccctgtcggatattcgtacgcgtgcc
gagcctgcggctgacggcagctaccgcctcaagggcaacaagatctttatctccggcggc
gaccacccgctgtcggaaaacatcgtacacatggtgctggccaagctgccggatgcgccg
gccggggtgaagggcatttcgctgtttatcgtgcccaaattcctggtcaacgacgacggc
agcctgggcgagcgcaacgatgtgctgctggccgggctgtttcacaagatgggttggcgt
ggcaccacttcaaccgcgctcaacttcggcgataacggtaactgcgtcggctatctggtg
ggcaaaccgcaccagggcctgagctgcatgttccagatgatgaacgaagcgcggattggc
gtgggcatgggcgccgtaatgctcggttacgccggttacctgtattcgctggaatatgct
cgcgaacgcccgcagggccggctgcctgacagcaaagaccccgcaacggcgccggtcgcg
atcatccagcacgctgacatcaagcgcatgctgctgacgcaaaaagcctacgtcgaaggc
gccttcgacctcggcctctatgccgcgcggctgtttgatgacaccacgaccctgcacacc
gaagccgagcgcaagagcgcccacgaactgctggacctgctcacccccatcgtcaaatcc
tggccttcggagttctgtctcaaggccaacgaactggcgatccagatccttggcggccat
ggctacacccgcgaatacccggtggagcagtattaccgcgacaaccgtttgaacccgatt
cacgagggcacccacggcattcagtcgctggacttgctggggcgcaagctggcgcagaat
ggcggtgctggcctcaagcagctgattcgattgatcgccgagaccggcgcacgagcccag
caatacgcgtcactgaccgcgctgcgtgaaccactggaacagttggtcaaccgcctgcaa
accgtaacgattggtctgcttaccgatctcgcccagggcaaggtcaacaacagcctggcg
aactcggcgctgtacctgaaagtgttcgggcacacggtgatcggctggcgctggctggaa
caggcgattcgcgccgaggaagggctggccaaaggcaatgccgcggacgcggccttctat
aaaggcaagctccaggccgcccggtacttcctgacctgggaagtaccgggttgccatcac
gaactggacattctggaggcgcgcgacgacacgtgcctggggatgcaggatgagtggttc
tag

DBGET integrated database retrieval system