KEGG   Cutibacterium avidum: PALO_10895
Entry
PALO_10895        CDS       T02632                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
pra  Cutibacterium avidum
Pathway
pra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    PALO_10895
Enzymes [BR:pra01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     PALO_10895
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF2937
Other DBs
NCBI-ProteinID: AGJ78762
Position
complement(2397183..2397656)
AA seq 157 aa
MSDPDQERVERYEALRAELADLDDAALKERFWQLCEQVMTPVVDLARTHTTPSIERSVLL
RMGIDSVTTHAVVENVFAAGLGGKGAGHAVLRLSRRDGMDLRDAVTRIAEDPKSLDGLFD
GSPLPPQRHRRNPRKESRHDHPRLRTSGTTVASSPTE
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtccgacccggatcaggagcgcgtcgaacgctacgaggccctgcgtgccgagctcgcc
gacctcgatgacgctgctctcaaggaacgcttctggcagctgtgcgagcaggtcatgacc
ccggtcgtcgacctcgcccgcacccacaccacaccatcgatcgaacggtccgtcctgctg
cgcatggggatcgactccgtgacgacccacgccgtcgtcgagaacgtctttgccgcagga
ctgggcggcaagggggccggccacgccgtactgcggttgtcccgtcgtgacggcatggac
ctgcgcgacgccgtcacccgcatcgccgaggaccccaagtccctcgacggactgttcgac
ggcagcccactgcccccgcaacggcaccgacggaatccgaggaaggagtcccggcatgac
catccaagattgcgaacctctggaacgacggtggcttcttccccaacggagtga

DBGET integrated database retrieval system