KEGG   Pieris rapae (cabbage white): 110991788Help
Entry
110991788         CDS       T05162                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00450  Selenocompound metabolism
prap00970  Aminoacyl-tRNA biosynthesis
prap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    110991788
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110991788
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:prap01007]
    110991788
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:prap03016]
    110991788
Enzymes [BR:prap01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     110991788
Amino acid related enzymes [BR:prap01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   110991788
Transfer RNA biogenesis [BR:prap03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    110991788
 Prokaryotic type
   Other AARSs
    110991788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 110991788
NCBI-ProteinID: XP_022113013
Position
Unknown
AA seq 556 aa AA seqDB search
MRLTTRFLSSVIQKRPFYITTPIFYVNAAPHLGHLYSAVVADAIQRFEKLTNPDTNVIFS
TGTDEHGTKIQQAAAKVNLSLPDYCTAISQEYRDLFKDFHVEFTDFVRTTEDRHKNAVGH
FWKKLVKKDYIYKAKYSGWYSVNDEAFVPDAQIRVDDTPDGKVRVSVESGHKLEWTEETN
YMFRLSAFKQHLREWLQTDGVVTPSKFQKQLQEMVENDVYLPDISVSRPASRVHWAIRVP
DDEEQSIYVWLDALINYLTVCGYPDDDHMKDKGRPWPADVQVVGKDILKFHGIYWPAFLM
AIKWHPPRQLLCHSHWTVDGSKMSKSLHNVVDPRHTVASHALRYLMLREATMADDANYSE
TKLINTANSELADTLGNLVSRSCGPALNPRCEFPALHHQELAECCQLQVTSQLLDAVERL
PDICRSHYSNYQFYKAVDAVIHALHLANLFFETLKPWELKKKPESQKQLDVVLHLTLETL
RICSIILQPIIPDITNKLLDKLQVGKNFRSWQHCEKPSWRLKGAIYETKNIQSGKFVLFQ
RIYVDKSNVKKKKASA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttacgactcgtttcttgtcttcagtcattcagaaaaggccattttatataaca
accccaatattttatgttaatgctgcacctcatttaggacatttatacagtgcagttgtg
gcagatgcaatacaaaggtttgaaaaattaacaaatcctgacacaaatgtgatctttagt
actggcacagatgaacatggtactaagatccagcaggctgccgctaaagtgaacctctct
ctaccggactactgtacagctatatctcaggaatatagagatttatttaaagattttcat
gttgagtttactgactttgtacgaactacagaagacaggcataaaaatgctgtagggcac
ttttggaaaaaattagttaaaaaagactatatatacaaagccaagtattcaggatggtac
agtgtgaatgatgaggcatttgtgcctgatgctcagattagagttgatgacacacctgat
ggcaaggttagagtgtcagtagaatcaggacacaaattagaatggacagaggagacaaac
tatatgtttagactgagtgcatttaagcagcatctcagagaatggcttcagacagatggt
gttgtgacacctagcaaatttcaaaagcagttgcaagaaatggtagaaaacgatgtttat
ctaccagatatttctgtcagtagaccggcatctagggtgcattgggctattcgagtgccg
gatgatgaagaacaaagtatatacgtgtggctggacgctctgataaattaccttacggtg
tgcggataccctgatgatgaccacatgaaggacaagggcagaccctggcctgcagatgta
caagttgtcggaaaggatatattgaaattccacggtatctactggccagcattcctaatg
gccatcaagtggcatccgccgcgtcagttgctctgccatagtcattggacggtcgatggc
agtaagatgtcaaaaagtctccacaacgtggtagacccaaggcatacggttgcgtcgcat
gcccttagatatttaatgttacgggaggcaacaatggcggatgacgctaattatagcgaa
acaaaactaatcaacacagcgaactccgagttagcagatactctgggcaatttagtgagt
agaagttgtggacctgcactgaacccgaggtgtgagtttcccgccttacatcaccaggaa
ttggcagagtgttgccagctccaagtgacgtcacagttattagatgcagtggaaaggttg
ccagacatatgtcgctcgcactattcaaactaccaattctataaagcagtggacgcggtc
atacacgccttacatttagccaatttgttcttcgaaactttaaaaccctgggagctcaag
aaaaaaccggaaagccaaaaacagttagatgttgtactccatttgacactcgaaacatta
cgtatttgctcaattattttacagccgataataccagatataacaaataaacttttagat
aaattgcaagtcgggaagaattttaggagttggcaacactgtgagaaaccttcttggcgg
ttgaagggcgccatctacgaaacgaaaaatatacaaagcggaaagtttgttttgtttcag
cgtatttatgttgataagagtaatgtgaaaaagaaaaaggctagtgcgtga

DBGET integrated database retrieval system