KEGG   Pieris rapae (cabbage white): 110991996Help
Entry
110991996         CDS       T05162                                 

Definition
(RefSeq) probable maleylacetoacetate isomerase 2 isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00350  Tyrosine metabolism
prap01100  Metabolic pathways
Module
prap_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110991996
Enzymes [BR:prap01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     110991996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 110991996
NCBI-ProteinID: XP_022113303
Position
Unknown
AA seq 219 aa AA seqDB search
MEGQISEKPVLYSYWRSSCSWRVRIALNLKEIPYDIKAVSLIKGGGEQHCNEYREVNPME
QVPSLVIDGHTLIESLSVMHYLEETRPQRSLMPQDCYKRAKVREICEVISSGIQPLQNLI
VLIHVGEEKKKEWAQHWITRGFRAVEKILSSVAGKYCVGDEISLADCCLIPQVFNARRFH
VDLRPFPIILRIDRELENHPAFRAAHPSAQPDCPPEAAK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggagggacaaatttctgaaaagccagtgctgtattcatactggcgtagctcatgctct
tggcgtgttcgtattgcattaaatctgaaagaaataccttatgacataaaagcagttagt
ttgataaaaggtggtggagaacaacactgcaatgaatatcgagaggtgaatccaatggaa
caagttccttcccttgttatagatgggcatacattaatagagtctcttagtgttatgcat
tatttggaggaaaccagacctcaaagatcactaatgccgcaggactgttataagagagct
aaagttagagagatttgtgaggtaatatcatcaggaattcaaccgctacagaatttaata
gttcttatccatgttggtgaagagaaaaaaaaggaatgggcgcagcactggataacaagg
ggatttcgagctgttgaaaaaattttatcttctgttgctggaaaatactgtgttggagat
gagattagcttggcagattgctgtctgatacctcaggtttttaacgctagaagatttcat
gtagaccttcgtccattcccaattattttacgtatcgatcgagaattggagaatcatccg
gcttttcgcgccgcccacccttcagctcagccggactgccctccagaagctgctaaataa

DBGET integrated database retrieval system