KEGG   Pieris rapae (cabbage white): 110992416Help
Entry
110992416         CDS       T05162                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP2
  KO
K09569  FK506-binding protein 2 [EC:5.2.1.8]
Organism
prap  Pieris rapae (cabbage white)
Brite
KEGG Orthology (KO) [BR:prap00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:prap03110]
    110992416
Enzymes [BR:prap01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110992416
Chaperones and folding catalysts [BR:prap03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    110992416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 110992416
NCBI-ProteinID: XP_022113921
Position
Unknown
AA seq 145 aa AA seqDB search
MNTVILRVCKILLFFVIFMGFIEHVVIASSPKKLQIGVKKRPTECPTKSKKGDLLHMHYT
GTLDDGTEFDSSIPRGNPLTFTLGAGQVIKGWDQGLIGMCEGEQRKLVIPPELAYGEAGA
PPKIPKSATLTFHVDLVKIERKDEL
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgttatacttcgtgtatgcaaaatattacttttctttgtaatttttatgggt
tttattgaacatgttgtcattgctagtagccctaaaaaattacaaattggtgttaaaaag
cgacctaccgaatgtcctacgaaaagtaaaaaaggagatctactgcacatgcattacacg
ggtacgcttgacgatggaacagaatttgatagttcaataccaagaggaaatcctctaaca
tttacactgggtgctggacaagtcattaaaggatgggatcagggattgataggcatgtgt
gagggagaacaacgcaaactagtaattccaccagagcttgcctatggagaggctggtgct
ccaccaaaaattccgaaatcagcaacacttacattccatgttgatctagtaaaaattgaa
agaaaggatgagctttaa

DBGET integrated database retrieval system